DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7028 and Hipk1

DIOPT Version :9

Sequence 1:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster
Sequence 2:XP_038958716.1 Gene:Hipk1 / 365895 RGDID:1304941 Length:1216 Species:Rattus norvegicus


Alignment Length:416 Identity:130/416 - (31%)
Similarity:207/416 - (49%) Gaps:50/416 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 CSAKEKRNEWDMFADQDVDSNFDVS-RKISPNTIVQNKHQHENPALT------DNWDDAEGYYRV 582
            |..|.|        .::||||..|. .:..|..::||:......|.|      .:....||.|::
  Rat   121 CGLKRK--------SEEVDSNGSVQIIEEHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQL 177

  Fly   583 RIGEVL---DNRYLVNGYTGQGVFSNVVRGRDQARGQANVAIKIIRNNEIMHKTGLRELEILKKL 644
            ...|:|   .|.|.|..:.|:|.|..|.:...::..:. |||||::|:....:.|..|:.||.:|
  Rat   178 VQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEI-VAIKILKNHPSYARQGQIEVSILSRL 241

  Fly   645 NDADPEDRFHCLRLYRHFFHKQHLCMVFEPLAMNLREVLKKYGKNVGLHIKAVRSYTQQLFLALK 709
            : ::..|.::.:|.|..|.||.|.|:|||.|..||.:.||: .|...|.:|.:|...||:..||.
  Rat   242 S-SENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQ-NKFSPLPLKYIRPILQQVATALM 304

  Fly   710 LLKKTGILHADIKPDNILVNE---NNLILKLCDFGSASAISDNEITPYLVSRFYRSPEIILGIPY 771
            .||..|::|||:||:||::.:   ....:|:.||||||.:|....:.||.||:||:||||||:|:
  Rat   305 KLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPF 369

  Fly   772 DYGIDTWSAGCTIYELYTGKILFSGKSNNQMLKFFMDVKGKIPNRIIRKGQFREQHFDQSCNFLY 836
            ...||.||.||.|.||:.|..|:.|.|....:::....:|.....::..|....:.|::..|..|
  Rat   370 CEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGY 434

  Fly   837 ----------HEID---KLTEREKIVV-----MPVVKPSRSLQ-QELIADQNLPDDQHRKVTQLK 882
                      ||::   |..|..|.:.     |..|..|..|: .:::|::   .|:...:    
  Rat   435 PLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEK---ADRREYI---- 492

  Fly   883 DLLENMFALDPAKRISLNQALVHPFI 908
            |||:.|..:|..||::..:.|.|.|:
  Rat   493 DLLKKMLTIDADKRVTPLKTLNHQFV 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 110/338 (33%)
S_TKc 599..908 CDD:214567 108/330 (33%)
Hipk1XP_038958716.1 STKc_HIPK1 174..528 CDD:271130 115/355 (32%)
PHA03247 <623..930 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.