DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7028 and Cdc2rk

DIOPT Version :9

Sequence 1:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster


Alignment Length:324 Identity:84/324 - (25%)
Similarity:133/324 - (41%) Gaps:70/324 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 GQGVFSNVVRGRDQARGQANVAIKIIR---NNEIMHKTGLRELEILKKLNDADPEDRFHCLRLYR 660
            |:|.:..|.|.|| .|....||:|.:|   ..:.:..:||||:.|||:.:..      :.:||..
  Fly    60 GEGSYGIVYRARD-TRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHE------NIVRLRE 117

  Fly   661 HF-------------FHKQHLCMVFEPLAMNLREVLKKYGKNVGLHIKAVRSYTQQLFLALKLLK 712
            ..             |.:|.|..|.:.::....|             ..|:..|.|:..|||.|.
  Fly   118 VVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTE-------------SEVKCITLQVLKALKYLH 169

  Fly   713 KTGILHADIKPDNILVNENNLILKLCDFGSASAISD--NEITPYLVSRFYRSPEIILGI-PYDYG 774
            ...::|.|:|..|:|:.:...| |:.|||.|...|:  ..:||.:|:.:||:||::||. .:...
  Fly   170 SRFMIHRDLKVSNLLMTDKGCI-KVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTA 233

  Fly   775 IDTWSAGCTIYELYTGKILFSGKSNNQMLKFFMDVKGKIPNRIIRKGQFREQHFDQSCNFLYHEI 839
            :|.|:.||.:.||..||.|..|.|....|...:|:.| .|:..|..| |.:              
  Fly   234 VDMWAFGCILGELLLGKPLLPGNSEIAQLDMIIDLLG-APSESIWPG-FAD-------------- 282

  Fly   840 DKLTEREKIVVMPVVKPSRSLQQELIADQNLPDDQHRKVTQLKDLLENMFALDPAKRISLNQAL 903
                       :|.|:.....||..   .||....|......::||..:|..:|..|.:..:.|
  Fly   283 -----------LPAVQNFTLSQQPY---NNLTPKFHMIGQSGRNLLNILFIYNPKTRATAEECL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 84/324 (26%)
S_TKc 599..908 CDD:214567 84/324 (26%)
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 84/324 (26%)
S_TKc 53..337 CDD:214567 84/324 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442418
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.