DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7028 and Cdk1

DIOPT Version :9

Sequence 1:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster


Alignment Length:340 Identity:94/340 - (27%)
Similarity:150/340 - (44%) Gaps:95/340 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 GQGVFSNVVRGRDQARGQANVAIKIIR---NNEIMHKTGLRELEILKKLNDADPEDRFHCL---- 656
            |:|.:..|.:||::..||. ||:|.||   ::|.:..|.:||:.:||:|.    .:...||    
  Fly    11 GEGTYGVVYKGRNRLTGQI-VAMKKIRLESDDEGVPSTAIREISLLKELK----HENIVCLEDVL 70

  Fly   657 ----RLYRHFFHKQHLCMVFEPLAMNLREVLKKYGKNVGLHIKAVRSYTQQLFLALKLLKKTGIL 717
                |:|          ::||.|:|:|::.:.....:..:..:.||||..|:..|:....:..:|
  Fly    71 MEENRIY----------LIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVL 125

  Fly   718 HADIKPDNILVNENNLILKLCDF--GSASAISDNEITPYLVSRFYRSPEIILGIP-YDYGIDTWS 779
            |.|:||.|:|::::.|| |:.||  |.:..|.....|..:|:.:||:||::||.| |...:|.||
  Fly   126 HRDLKPQNLLIDKSGLI-KVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWS 189

  Fly   780 AGCTIYELYTGKILFSGKSNNQMLKFFMDVKGKIPNRIIRKGQFREQHFDQSCNFLYHEIDKLTE 844
            .||...|:.|.|.||.|.|                                       |||:|..
  Fly   190 IGCIFAEMATRKPLFQGDS---------------------------------------EIDQLFR 215

  Fly   845 REKIVVMPV--VKPSRSLQQELIADQNLPD--------DQHRKVTQLK-------DLLENMFALD 892
            ..:|:..|.  :.|..:         :|||        ..::...|||       ||::.|...|
  Fly   216 MFRILKTPTEDIWPGVT---------SLPDYKNTFPCWSTNQLTNQLKNLDANGIDLIQKMLIYD 271

  Fly   893 PAKRISLNQALVHPF 907
            |..|||....|.||:
  Fly   272 PVHRISAKDILEHPY 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 94/340 (28%)
S_TKc 599..908 CDD:214567 94/340 (28%)
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 94/340 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.