DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7028 and Dyrk4

DIOPT Version :9

Sequence 1:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster
Sequence 2:XP_038964750.1 Gene:Dyrk4 / 312721 RGDID:1306800 Length:649 Species:Rattus norvegicus


Alignment Length:343 Identity:113/343 - (32%)
Similarity:170/343 - (49%) Gaps:28/343 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 NWDDAEGYYRVRIGEVLDNRYLVNGYTGQGVFSNVVRGRDQARGQANVAIKIIRNNEIMHKTGLR 636
            ::||..|.|...:.:.:..||.|....|:|.|..|.:..|....:. ||:|||||.:..|...|.
  Rat   216 SFDDEHGSYVKVLHDHIAYRYEVLDMIGKGSFGQVAKCLDHKNNEL-VALKIIRNKKRFHHQALV 279

  Fly   637 ELEILKKLNDADPEDRFHCLRLYRHFFHKQHLCMVFEPLAMNLREVLKKYGKNVGLHIKAVRSYT 701
            ||:||:.|...|.::..:.:.:...|:.:.|||:.||.|.:||.|::|. ....|..:..||.:|
  Rat   280 ELKILEALRRKDKDNTHNVVHMKDFFYFRNHLCITFELLGINLYELMKN-NSFQGFSLSIVRRFT 343

  Fly   702 QQLFLALKLLKKTGILHADIKPDNI-LVNENNLILKLCDFGSASAISDNEITPYLVSRFYRSPEI 765
            ..:...|::|....|:|.|:||:|| |.:...:.:|:.|||| |.....::..|:.||||||||:
  Rat   344 LSVLKCLQMLYVEKIIHCDLKPENIVLYHRGQVTVKVIDFGS-SCYEHQKVYTYIQSRFYRSPEV 407

  Fly   766 ILGIPYDYGIDTWSAGCTIYELYTGKILFSGKSNNQMLKFFMDVKGKIPNRIIRKGQFREQHFDQ 830
            |||.||:..||.||.||.:.|||||..||.|::..:.|...|:|.|..|..:|:....|:..||.
  Rat   408 ILGHPYNMAIDMWSLGCIMAELYTGYPLFPGENEVEQLACIMEVLGLPPTHLIQTATRRQIFFDS 472

  Fly   831 S---CNFLYHEIDKLTEREKIVVMPVVKPSRSLQQELIADQNLPDDQHRKVTQLKDLLENMFALD 892
            .   .|...:..:|.....|.:.| |||...|                    ...|.|......:
  Rat   473 KGLPKNITNNRGEKRYPNSKDLPM-VVKTYDS--------------------SFLDFLRRCLVWE 516

  Fly   893 PAKRISLNQALVHPFIQE 910
            |:.|::.:|||.|.:|.|
  Rat   517 PSLRMTPDQALKHAWIHE 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 107/320 (33%)
S_TKc 599..908 CDD:214567 104/312 (33%)
Dyrk4XP_038964750.1 PKc_DYRK4 192..532 CDD:271127 111/339 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.