DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7028 and Hipk4

DIOPT Version :9

Sequence 1:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_001028487.2 Gene:Hipk4 / 233020 MGIID:2685008 Length:616 Species:Mus musculus


Alignment Length:370 Identity:108/370 - (29%)
Similarity:176/370 - (47%) Gaps:61/370 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   570 TDNWDDAEGYYRVRIGEVLDNRYLVNGYTGQGVFSNVVRGRDQARGQANVAIKIIRNNEIMHKTG 634
            ||.:|         |.|||          |:|.|..|.:|..::.|:. |||||::|:....:..
Mouse     8 TDCYD---------IIEVL----------GKGTFGEVAKGWRRSTGEM-VAIKILKNDAYRSRII 52

  Fly   635 LRELEILKKLNDADPEDRFHCLRLYRHFFHKQHLCMVFEPLAMNLREVLKKYGKNVGLHIKAVRS 699
            ..||::|:.:...|| |..|.:|....|.......:|||.|..||.| .:|......|..:.:|:
Mouse    53 KNELKLLRCVRGLDP-DEAHVIRFLEFFHDALKFYLVFELLEQNLFE-FQKENNFAPLPARHIRT 115

  Fly   700 YTQQLFLALKLLKKTGILHADIKPDNILVNENN---LILKLCDFGSASAISDNEIT--PYLVSRF 759
            .|.|:..||..||:..|:|||:||:||::.:..   ..:|:.||||||..|:....  ||:.|||
Mouse   116 VTLQVLRALARLKELAIIHADLKPENIMLVDQTRCPFRVKVIDFGSASIFSEVRYVKEPYIQSRF 180

  Fly   760 YRSPEIILGIPYDYGIDTWSAGCTIYELYTGKILFSGKSNNQMLKFFMDVKGKIPNRIIRKGQFR 824
            ||:|||:||:|:...:|.||.||.:.||:.|..|:.|.:....:::..:.:| :|...:.....:
Mouse   181 YRAPEILLGLPFCEKVDVWSLGCVMAELHLGWPLYPGNNEYDQVRYICETQG-LPKPHLLHAARK 244

  Fly   825 EQHF---------------DQSCNFLYHEIDKLTEREKIVVMPVVKPSRSLQQ-------ELIAD 867
            ..||               ..|.::|.....:..||.|.::       :||.|       ..::.
Mouse   245 AHHFFKRNPHPDATNPWQLKSSADYLAETKVRPLERRKYML-------KSLDQIETVNGGGAVSR 302

  Fly   868 QNLPD----DQHRKVTQLKDLLENMFALDPAKRISLNQALVHPFI 908
            .:.||    .:|..:..:.:|::.|...:..:|||.:.||.|||:
Mouse   303 LSFPDREALAEHADLKSMVELIKRMLTWESHERISPSAALRHPFV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 100/347 (29%)
S_TKc 599..908 CDD:214567 100/339 (29%)
Hipk4NP_001028487.2 PKc_like 11..347 CDD:304357 105/365 (29%)
S_TKc 11..347 CDD:214567 105/365 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 487..616
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.