DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7028 and DYRK1A

DIOPT Version :9

Sequence 1:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_001387.2 Gene:DYRK1A / 1859 HGNCID:3091 Length:763 Species:Homo sapiens


Alignment Length:479 Identity:144/479 - (30%)
Similarity:219/479 - (45%) Gaps:70/479 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 PHN---------SVSYESRSTSQGSSQRERPLRTPSPTMPCPNPLISEIPKDREDMDNSTSQK-- 523
            ||:         ::|.:..|....|.|.::||  .:..||....|...:|:...|...:..:|  
Human    35 PHSHQYSDRRQPNISDQQVSALSYSDQIQQPL--TNQVMPDIVMLQRRMPQTFRDPATAPLRKLS 97

  Fly   524 ------------TCSAKEKRNEWDMFADQDVDSNFDVSRKISPNTIVQNKHQHENPALTDNWDDA 576
                        ...||:||....   .|..||:                |:.|.....|.:||.
Human    98 VDLIKTYKHINEVYYAKKKRRHQQ---GQGDDSS----------------HKKERKVYNDGYDDD 143

  Fly   577 EGYYRVRIGEVLDNRYLVNGYTGQGVFSNVVRGRDQARGQANVAIKIIRNNEIMHKTGLRELEIL 641
            ...|.|:.||...:||.::...|:|.|..||:..|:.. |..||||||:|.:........|:.:|
Human   144 NYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVE-QEWVAIKIIKNKKAFLNQAQIEVRLL 207

  Fly   642 KKLNDADPEDRFHCLRLYRHFFHKQHLCMVFEPLAMNLREVLKKYGKNVGLHIKAVRSYTQQLFL 706
            :.:|..|.|.:::.:.|.|||..:.|||:|||.|:.||.::|:..... |:.:...|.:.||:..
Human   208 ELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFR-GVSLNLTRKFAQQMCT 271

  Fly   707 ALKLL--KKTGILHADIKPDNILV-NENNLILKLCDFGSASAISDNEITPYLVSRFYRSPEIILG 768
            ||..|  .:..|:|.|:||:|||: |.....:|:.||||:..:. ..|..|:.||||||||::||
Human   272 ALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLG-QRIYQYIQSRFYRSPEVLLG 335

  Fly   769 IPYDYGIDTWSAGCTIYELYTGKILFSGKSNNQMLKFFMDVKGKIPNRII----RKGQFREQHFD 829
            :|||..||.||.||.:.|::||:.||||.:....:...::|.|..|..|:    :..:|.|:..|
Human   336 MPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPD 400

  Fly   830 QSCNFLYHEIDKLTEREKIVVMPVVKPSRSLQQELIADQNLP------DDQHRKVTQL--KDLLE 886
            .:.|.      |.|:..|....|  ..:|.|...|..:...|      :..|.....|  |||:.
Human   401 GTWNL------KKTKDGKREYKP--PGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLIL 457

  Fly   887 NMFALDPAKRISLNQALVHPFIQE 910
            .|...||..||....||.|.|.::
Human   458 RMLDYDPKTRIQPYYALQHSFFKK 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 113/331 (34%)
S_TKc 599..908 CDD:214567 111/323 (34%)
DYRK1ANP_001387.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..57 4/21 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..136 7/39 (18%)
Bipartite nuclear localization signal. /evidence=ECO:0000255 117..134 6/35 (17%)
PKc_DYRK1 148..484 CDD:271128 117/345 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 408..442 7/35 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 485..540
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 596..679
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 744..763
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.