DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13876 and c3orf38

DIOPT Version :9

Sequence 1:NP_612009.1 Gene:CG13876 / 38031 FlyBaseID:FBgn0035109 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001037913.1 Gene:c3orf38 / 733522 XenbaseID:XB-GENE-963603 Length:305 Species:Xenopus tropicalis


Alignment Length:271 Identity:64/271 - (23%)
Similarity:123/271 - (45%) Gaps:27/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISDSQKKGLRELL--LNDKNLTVLLQLAKGATKNMCKTEDPEEALRLITTHIPDIYVLLSKRAIK 65
            ::..:|.|.|:||  :.|.:   ::.||:..|..|.:....|||:..|.|:..:...||::|.:.
 Frog     4 LNGREKAGCRQLLGEMEDSD---IMSLAETVTNRMIRVFSREEAMDAILTYSKNAAELLNRRKVY 65

  Fly    66 KELLFTYLSNRRADAATDFSKADLIAKVIQYWKQEHKSSIELSGDQTS----SSLHIQSEEDYPI 126
            ::::|.||:.::...:....|..||.:.:::|::....|:..:.:.:|    :|:..|.:.:...
 Frog    66 RDIIFKYLAAKKIAVSPSSEKNQLIQRALEFWRESATESVSSAPESSSFNGQNSVPSQDKSNDTS 130

  Fly   127 HT-------IARKFGEWFFERFNADALSL---------VDLWADAALHLTIIASDGINEWECTTA 175
            |:       :...|..||:...|:....|         ...|.:..|......:....|..|...
 Frog   131 HSGSLDCQLLGEHFCRWFYPLLNSQNPILGCEKGYWGPQHFWENTVLKFAYRTTQESTEEYCGAQ 195

  Fly   176 AEVLSALTSAKQQFDFYFNPNLTHAGIQGRMDSYGHFLVICCGTLHSRDSCVGIFECAFGLFRDP 240
            ...|..|...::: ...|||::...|::..:..:|..:|...||:|..:.|:||||..|||.|.|
 Frog   196 MASLRLLALTREE-RLLFNPSIDTGGLKCAISRHGLVVVAVAGTIHRDNQCLGIFEQIFGLIRCP 259

  Fly   241 LADNNWKPKKV 251
            :. .:||.|.|
 Frog   260 VT-ASWKIKNV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13876NP_612009.1 DUF4518 6..256 CDD:291669 64/268 (24%)
c3orf38NP_001037913.1 DUF4518 7..273 CDD:291669 64/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8769
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H27867
Inparanoid 1 1.050 77 1.000 Inparanoid score I5085
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1399225at2759
OrthoFinder 1 1.000 - - FOG0008180
OrthoInspector 1 1.000 - - oto103910
Panther 1 1.100 - - LDO PTHR21084
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6144
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.