DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13876 and LOC100362724

DIOPT Version :9

Sequence 1:NP_612009.1 Gene:CG13876 / 38031 FlyBaseID:FBgn0035109 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_003752075.1 Gene:LOC100362724 / 100362724 RGDID:2324134 Length:348 Species:Rattus norvegicus


Alignment Length:271 Identity:74/271 - (27%)
Similarity:126/271 - (46%) Gaps:32/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISDSQKKGLRELLL---NDKNLTVLLQLAKGATKNMCKTEDPEEALRLITTHIPDIYVLLSKRAI 64
            :|..:.:|.|.||.   ||:    ::.|....|..:.:..|.::|:|.|..:..::..||.::.:
  Rat     4 LSHLESEGCRNLLRMLDNDE----IMALCDTVTNRLVQPVDRQDAIRAILVYSQNVEELLRRKKV 64

  Fly    65 KKELLFTYLSNRRADAATDFSKADLIAKVIQYWKQEH---KSSIE-LSGDQTSSSLHIQSEEDYP 125
            .:|::|.||:.:.........|..||.....||:::.   |.:.| :...:.|.....|::||..
  Rat    65 HREVIFKYLATQGVVVPPTTEKHGLIQYAKSYWEEQSPKLKETAEPVKKTEDSQLFEQQAKEDKE 129

  Fly   126 IHTI-ARKFGE----WFFERFNA---------DALSLVDLWADAALHLTIIASD-GINEWECTTA 175
            ...: .|:.||    ||||..|:         |.......|.|..|......|: .:.::|   .
  Rat   130 AEKVDFRRLGEEFCHWFFELLNSQNPFLGPPQDEWGPQHFWHDVKLRFYYNTSEQNMTDYE---G 191

  Fly   176 AEVLS--ALTSAKQQFDFYFNPNLTHAGIQGRMDSYGHFLVICCGTLHSRDSCVGIFECAFGLFR 238
            ||::|  .|:..|::| .:.:|||...|::.....:|..:|...||:|..:||:||||..|||.|
  Rat   192 AEMVSLRLLSLVKEEF-LFLSPNLDSQGLKCASSPHGLVMVGVAGTVHRGNSCLGIFEQIFGLIR 255

  Fly   239 DPLADNNWKPK 249
            .|..:|.||.|
  Rat   256 SPFVENTWKIK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13876NP_612009.1 DUF4518 6..256 CDD:291669 73/268 (27%)
LOC100362724XP_003752075.1 DUF4518 8..273 CDD:405664 73/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1399225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.