DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13876 and si:ch211-261p9.4

DIOPT Version :9

Sequence 1:NP_612009.1 Gene:CG13876 / 38031 FlyBaseID:FBgn0035109 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_002663392.1 Gene:si:ch211-261p9.4 / 100330300 ZFINID:ZDB-GENE-081104-205 Length:285 Species:Danio rerio


Alignment Length:275 Identity:78/275 - (28%)
Similarity:134/275 - (48%) Gaps:33/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISDSQKKGLRELL----LNDKNLTVLLQLAKGATKNMCKTEDPEEALRLITTHIPDIYVLLSKRA 63
            :|..::...|:|:    |:|     |..|....|..:...|..|||:..|..:..|...||.::.
Zfish     4 LSTKEQIECRKLIALLPLDD-----LFALKDTVTNRLIAVESSEEAIEAIIAYSQDAEELLKRKK 63

  Fly    64 IKKELLFTYLSNRRADAATDFSKADLIAKVIQYWKQEHKSSIELSGDQ--TSSSLHIQSEEDYPI 126
            :.::::|.||:|.....|.:..|..||.|.|::|     ||.|:|..:  |::|..: .:....:
Zfish    64 MHRDVIFKYLANEGVVMAPNTEKHQLIRKTIEFW-----SSGEISKPERNTNNSYEV-GDGLSDL 122

  Fly   127 HTIARKFGEWFFERFNADALS----LVD-----LWADAALHLTIIASD-GINEWECTTAAEVLS- 180
            ..:.::|.:|||...|:...|    :.|     .|.:.:|.|.:...: .::|:   :.||::| 
Zfish   123 AALGKQFCQWFFCLLNSQNPSQGHPVQDWGPQHFWENVSLRLLLCTGEQRVDEF---SGAELVSK 184

  Fly   181 ALTSAKQQFDFYFNPNLTHAGIQGRMDSYGHFLVICCGTLHSRDSCVGIFECAFGLFRDPLADNN 245
            .|.:..::....|.|||...|::.....:|..||...||:|..::|:||||..|||.|.|:.:|.
Zfish   185 RLQALAEEERLLFCPNLEGHGLKCMSSPHGLVLVAVAGTIHRDNTCLGIFEQVFGLIRSPMDNNF 249

  Fly   246 WKPKKVKCFLKSEAQ 260
            ||.|.|.  :|.|||
Zfish   250 WKIKLVN--IKIEAQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13876NP_612009.1 DUF4518 6..256 CDD:291669 73/266 (27%)
si:ch211-261p9.4XP_002663392.1 DUF4518 7..259 CDD:291669 73/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581487
Domainoid 1 1.000 91 1.000 Domainoid score I7720
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H27867
Inparanoid 1 1.050 92 1.000 Inparanoid score I5083
OMA 1 1.010 - - QHG49906
OrthoDB 1 1.010 - - D1399225at2759
OrthoFinder 1 1.000 - - FOG0008180
OrthoInspector 1 1.000 - - oto40539
orthoMCL 1 0.900 - - OOG6_109677
Panther 1 1.100 - - LDO PTHR21084
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6144
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.