DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and VNN1

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_004657.2 Gene:VNN1 / 8876 HGNCID:12705 Length:513 Species:Homo sapiens


Alignment Length:344 Identity:71/344 - (20%)
Similarity:125/344 - (36%) Gaps:116/344 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LAKCNKIWISLGGVHERNDQK---------------IFNAHVLLNEKGELAAVYRKLHMFDVTTK 151
            |||.|.|::    |....|:|               .:|..|:.:.:|:|.|.|.|.::|....:
Human   127 LAKNNSIYV----VANIGDKKPCDTSDPQCPPDGRYQYNTDVVFDSQGKLVARYHKQNLFMGENQ 187

  Fly   152 EVRLRESDTVTPGYCLERPVSTPVGQIGLQICYDLRFAEPAV-LLRKLGANLLTYPSAFT----- 210
            ....:|.:.||        .:|..|..|:..|:|:.|.:||| |::....:.:.:|:|:.     
Human   188 FNVPKEPEIVT--------FNTTFGSFGIFTCFDILFHDPAVTLVKDFHVDTIVFPTAWMNVLPH 244

  Fly   211 YATGKAH--WEILLRARAIETQCFVVAAAQIG-----------WHNQKRQSWG------------ 250
            .:..:.|  |.:.:|...:.:.....:....|           :|...:...|            
Human   245 LSAVEFHSAWAMGMRVNFLASNIHYPSKKMTGSGIYAPNSSRAFHYDMKTEEGKLLLSQLDSHPS 309

  Fly   251 HSMIVSPWGNVLADCSEQELDIGTAE------------VDLSVLQSLY----QTMPCF------E 293
            ||.:|: |.:..:  |.:.|..|..|            |.|:.:...|    :.:.|.      |
Human   310 HSAVVN-WTSYAS--SIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSE 371

  Fly   294 HRRNDIYALTAYNLRSKEPTQDRPFATNIVDKRTIFYESEHCFAFTNLRCVVKGHVLVSTKRVTP 358
            :..|::|||.|::            ..:.|:.|   |..:.|   |.|:|          |....
Human   372 NIPNEVYALGAFD------------GLHTVEGR---YYLQIC---TLLKC----------KTTNL 408

  Fly   359 RLCGLDCAEMA----DMFT 373
            ..|| |.||.|    :||:
Human   409 NTCG-DSAETASTRFEMFS 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 50/261 (19%)
FHIT 317..436 CDD:238606 16/61 (26%)
VNN1NP_004657.2 biotinidase_like 25..330 CDD:143591 43/217 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.