DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and YIL165C

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_012101.1 Gene:YIL165C / 854641 SGDID:S000001427 Length:119 Species:Saccharomyces cerevisiae


Alignment Length:111 Identity:25/111 - (22%)
Similarity:50/111 - (45%) Gaps:26/111 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 AIETQCFVVAAAQ-------IGW--------HNQKRQSW---------GHSMIVSPWGNVLADCS 266
            |.|.:.|:::|.|       :|:        ..:|...|         |.|:|:.|:|.::|...
Yeast     5 AYEGRLFLISAVQFMPDATAMGFGEIIDQATGKRKLPGWPSADDNCINGGSVIIDPYGEIIAGPL 69

  Fly   267 EQELDIGTAEVDLSVL-QSLYQTMPCFEHRRNDIYALTAYNLRSKE 311
            ..:..:.|||::..:: ::.:...|...:.|.|::.||. |.||.:
Yeast    70 LGQEGLLTAEINTDLIAEARFDLDPVGHYARGDVFQLTV-NERSHD 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 18/94 (19%)
FHIT 317..436 CDD:238606
YIL165CNP_012101.1 nitrilase <1..110 CDD:416265 22/105 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.