DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and NTA1

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_012596.3 Gene:NTA1 / 853525 SGDID:S000003823 Length:457 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:43/220 - (19%)
Similarity:81/220 - (36%) Gaps:61/220 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTLVNTTRRSIVIAIHQQLRRMSVQKRKDQSATIAVGQMRSTSDKA-ANLSQVIELVDRAKSQN 64
            |||.:..:.:.:||.::.|                 :||:..|..:. :.|.:|.:.....|.. 
Yeast    11 MSTKLLVSLKVLVIQLNPQ-----------------IGQVDQTIKRTWSILDKVTKSATYVKPD- 57

  Fly    65 ACMLFLPE--CCDFVGESRTQTI----ELSEGLDGELMAQYRELAKCNKIWISLGGVHERNDQKI 123
              ::..||  ...:...:|...:    :..||...||.....|..:|..|   :|...:.::||:
Yeast    58 --IILFPEFALTGYSFHARKDILPYVTKKDEGPSFELAKSISEKFQCYTI---IGYPEDDDEQKL 117

  Fly   124 FNAHVLLNEKGELAAVYRKLHMFDVT-------------------TKEVRLRESDTVTPGYCLER 169
            :|:.:::|.:||....|||..::|..                   :|..:|...|:......|:.
Yeast   118 YNSALVVNPQGEQIFNYRKTFLYDTEMNWDCEENPEGFQTFPMDFSKCAKLSNEDSYNRDVTLKA 182

  Fly   170 PVSTPVGQIGLQICYDL---RFAEP 191
            .:.         ||.||   :|..|
Yeast   183 SIG---------ICMDLSPYKFMAP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 37/187 (20%)
FHIT 317..436 CDD:238606
NTA1NP_012596.3 ScNTA1_like 20..315 CDD:143590 40/211 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.