DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and HNT2

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_010591.1 Gene:HNT2 / 851899 SGDID:S000002713 Length:217 Species:Saccharomyces cerevisiae


Alignment Length:129 Identity:50/129 - (38%)
Similarity:81/129 - (62%) Gaps:8/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 RSKEP-TQDRP--FATNIVDKRTIFYESEHCFAFTNLRCVVKGHVLVSTKRVTP-RLCGLDCAEM 368
            ::|:| :.::|  |:..:|.:: :||:|::.:|..||:.:|.||||:...|.|. .|..|...|.
Yeast     5 KTKKPKSMNKPIYFSKFLVTEQ-VFYKSKYTYALVNLKPIVPGHVLIVPLRTTVLNLSDLTMPES 68

  Fly   369 ADMFTTVCLVQRLLEKIYQTTSATVTVQDGAQAGQTVPHVHFHIMPR-RLGDFGHNDQIYVKLD 431
            .|.|.|:.|:.|.::..|:..|..|.:|||.:|||:|||:|.||:|| ::.:.|  |.||.|||
Yeast    69 QDYFKTLQLIHRFIKWQYKADSINVAIQDGPEAGQSVPHLHTHIIPRYKINNVG--DLIYDKLD 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596
FHIT 317..436 CDD:238606 48/119 (40%)
HNT2NP_010591.1 FHIT 16..135 CDD:238606 47/118 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I2075
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R813
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.