DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and hint2

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001077041.1 Gene:hint2 / 798688 ZFINID:ZDB-GENE-070410-139 Length:161 Species:Danio rerio


Alignment Length:145 Identity:39/145 - (26%)
Similarity:59/145 - (40%) Gaps:20/145 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 LSVLQSLYQTMPCFEHRRNDIYALTAYNLRSK----EPTQDRPFATNIVDK---RTIFYESEHCF 336
            ||| :|.|.|:       ||...| |.....|    |||    ..|.|:||   ..|.||.:.|.
Zfish    23 LSV-KSCYSTI-------NDEVRL-AQEASKKYGKLEPT----IFTKIIDKTVPAVIIYEDDKCL 74

  Fly   337 AFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMADMFTTVCLVQRLLEKIYQTTSATVTVQDGAQA 401
            ||.::......|.||..:...||:......:...:...:.:.:.:.:|........|.:.||...
Zfish    75 AFRDVNPQAPVHYLVIPRIPIPRISEAHDEDSLILGHLLVVAKNIAKKEGLAEGYRVVINDGKNG 139

  Fly   402 GQTVPHVHFHIMPRR 416
            .|:|.|:|.|::..|
Zfish   140 AQSVYHLHIHVLGGR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 6/16 (38%)
FHIT 317..436 CDD:238606 25/103 (24%)
hint2NP_001077041.1 PKCI_related 51..153 CDD:238607 26/105 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.