DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and hint3

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001039146.1 Gene:hint3 / 733971 XenbaseID:XB-GENE-1000078 Length:153 Species:Xenopus tropicalis


Alignment Length:123 Identity:24/123 - (19%)
Similarity:45/123 - (36%) Gaps:21/123 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 IFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMADMFTTVCLVQRLLEKIYQTTSA- 391
            :.:..:....|.::|..|..|.||..|:...     .|..:..  ..|.|::.::|....|... 
 Frog    34 LLHSDDDLVCFKDIRPAVTHHYLVVPKKHVG-----TCKTLTK--DHVQLIKTMMEVGKSTLQKN 91

  Fly   392 TVTVQDGAQAGQTVP------HVHFHIM--PRRLGDFGH-----NDQIYVKLDERAEE 436
            .||..:..:.|...|      |:|.|::  ..:||....     |...::..||..::
 Frog    92 NVTDLEDIRLGFHYPPFCSISHLHLHVLAPASQLGFLSRMIYRVNSYWFITADELIDQ 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596
FHIT 317..436 CDD:238606 24/121 (20%)
hint3NP_001039146.1 HIT_like 18..120 CDD:381879 19/92 (21%)
Histidine triad motif 113..117 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.