DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and Hint2

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_081147.1 Gene:Hint2 / 68917 MGIID:1916167 Length:163 Species:Mus musculus


Alignment Length:111 Identity:30/111 - (27%)
Similarity:46/111 - (41%) Gaps:25/111 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 TNIVDK---RTIFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMADMFTTVCLVQRL 381
            :.|:|:   ..|.||.:.|..|.::......|.||..::..||   :..||..|        |:|
Mouse    57 SRILDRSLPADILYEDQQCLVFRDVAPQAPVHFLVIPRKPIPR---ISQAEEDD--------QQL 110

  Fly   382 L-------EKIYQTTSA----TVTVQDGAQAGQTVPHVHFHIMPRR 416
            |       :||.|....    .:.|.||....|:|.|:|.|::..|
Mouse   111 LGHLLLVAKKIAQAQGLKDGYRLVVNDGKMGAQSVYHLHIHVLGGR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596
FHIT 317..436 CDD:238606 30/111 (27%)
Hint2NP_081147.1 PKCI_related 53..155 CDD:238607 29/108 (27%)
Histidine triad motif 147..151 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.