DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and Hint3

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:XP_006512886.1 Gene:Hint3 / 66847 MGIID:1914097 Length:200 Species:Mus musculus


Alignment Length:145 Identity:29/145 - (20%)
Similarity:53/145 - (36%) Gaps:41/145 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 KRTIFY-ESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGL--DCAEM-------ADMFTTV---- 375
            |..:|: |:|....|.:::.....|.||..|:.......|  |..||       ..:||.|    
Mouse    43 KTELFHCENEDLVCFKDIKPAALYHYLVVPKKHIGSCKDLNKDHIEMVYSRSVLVAVFTRVWVSL 107

  Fly   376 CLVQRLLEKIYQTTSATVTVQDGAQAGQT------------------------VPHVHFHIMPRR 416
            .::...|::|.:|  ....|:....||:|                        :.|:|.|:: ..
Mouse   108 AVLYGTLQRINET--RLFRVESMVAAGKTMLERNNFTDFTDVRMGFHVPPFCSISHLHLHVI-AP 169

  Fly   417 LGDFGHNDQIYVKLD 431
            :.:||...::..:.|
Mouse   170 VKEFGFLSKLVYRQD 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596
FHIT 317..436 CDD:238606 29/145 (20%)
Hint3XP_006512886.1 aprataxin_related 30..168 CDD:238609 26/127 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.