DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and Fhit

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:XP_038949553.1 Gene:Fhit / 60398 RGDID:620448 Length:194 Species:Rattus norvegicus


Alignment Length:143 Identity:60/143 - (41%)
Similarity:83/143 - (58%) Gaps:5/143 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 FATNIVDKRTIFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMADMFTTVCLVQRLL 382
            |..:::....:|.::|..||..|.:.||.|||||...|...|...|...|:||:|.....|..::
  Rat    18 FGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLRPDEVADLFQVTQRVGTVV 82

  Fly   383 EKIYQTTSATVTVQDGAQAGQTVPHVHFHIMPRRLGDFGHNDQIYVKLD--ERAEEKPP---RTI 442
            ||.:|.||.|.::|||.:|||||.|||.||:||:.|||..||.||.:|.  :|.||..|   |:.
  Rat    83 EKHFQGTSITFSMQDGPEAGQTVKHVHVHILPRKSGDFRRNDNIYDELQKHDREEEDSPAFWRSE 147

  Fly   443 EERIEEAQIYRKF 455
            ||...||::.|.:
  Rat   148 EEMAAEAEVLRAY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596
FHIT 317..436 CDD:238606 51/119 (43%)
FhitXP_038949553.1 FHIT 18..137 CDD:238606 51/118 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8786
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.