DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and NIT2

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_064587.1 Gene:NIT2 / 56954 HGNCID:29878 Length:276 Species:Homo sapiens


Alignment Length:272 Identity:95/272 - (34%)
Similarity:154/272 - (56%) Gaps:4/272 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SATIAVGQMRSTSDKAANLSQVIELVDRAKSQNACMLFLPECCDFVGESRTQTIELSEGLDGELM 96
            |..:|:.|::.:|.|:.|:::....:..|.:|.|.::.||||.:....:: ...|.:|.:.||..
Human     3 SFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAK-YFPEYAEKIPGEST 66

  Fly    97 AQYRELAKCNKIWISLGGVHERNDQKIFNAHVLLNEKGELAAVYRKLHMFDVTTK-EVRLRESDT 160
            .:..|:||...|::..|.:.|.:..|::|...:....|.|.|.|||:|:||:... ::..:||.|
Human    67 QKLSEVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKT 131

  Fly   161 VTPGYCLERPVSTPVGQIGLQICYDLRFAEPAVLLRKLGANLLTYPSAFTYATGKAHWEILLRAR 225
            ::||.... ...||..::||.||||:||||.|.:..:.|..||.||.||...||.||||:|.|:|
Human   132 LSPGDSFS-TFDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRSR 195

  Fly   226 AIETQCFVVAAAQIGWHNQKRQSWGHSMIVSPWGNVLADCSEQELDIGTAEVDLSVLQSLYQTMP 290
            |::.|.:|..|:..........:||||.:|:|||.|||....:|. |..:::||..|..:.|.:|
Human   196 AVDNQVYVATASPARDDKASYVAWGHSTVVNPWGEVLAKAGTEEA-IVYSDIDLKKLAEIRQQIP 259

  Fly   291 CFEHRRNDIYAL 302
            .|..:|:|:||:
Human   260 VFRQKRSDLYAV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 90/262 (34%)
FHIT 317..436 CDD:238606
NIT2NP_064587.1 nit 5..265 CDD:143596 90/262 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154369at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.