DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and nit2

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001016633.2 Gene:nit2 / 549387 XenbaseID:XB-GENE-946902 Length:282 Species:Xenopus tropicalis


Alignment Length:259 Identity:94/259 - (36%)
Similarity:147/259 - (56%) Gaps:6/259 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KAANLSQVIELVDRAKSQNACMLFLPECCDFVGESRTQTI-ELSEGLDGELMAQYRELAKCNKIW 109
            |:.||::..:|:..|..:.|.::.||||  |.....|:.. |.:|.:.||...:..::||...|:
 Frog    23 KSENLNRACKLIKEAAQKGAQIVALPEC--FNSPYGTKYFPEYAEKIPGESTERLSQVAKECGIY 85

  Fly   110 ISLGGVHERNDQKIFNAHVLLNEKGELAAVYRKLHMFDVTTK-EVRLRESDTVTPGYCLERPVST 173
            :..|.:.|.:..|::|...:....|.|...:||:|:||:... ::|.:||:|::||.... ...|
 Frog    86 LIGGSIPEEDSGKLYNTCAVFGPDGTLLVKHRKIHLFDIDVPGKIRFQESETLSPGDSFS-VFET 149

  Fly   174 PVGQIGLQICYDLRFAEPAVLLRKLGANLLTYPSAFTYATGKAHWEILLRARAIETQCFVVAAAQ 238
            |..::|:.||||:||||.|.|..|.|..||.||.||...||.||||:|.||||::.|.:|..|:.
 Frog   150 PYCKVGVGICYDIRFAELAQLYSKKGCQLLVYPGAFNMTTGPAHWELLQRARALDNQVYVATASP 214

  Fly   239 IGWHNQKRQSWGHSMIVSPWGNVLADCSEQELDIGTAEVDLSVLQSLYQTMPCFEHRRNDIYAL 302
            .........:||||.||||||.|:|....:|..| :|::||..|..:.:.:|....||:|:|::
 Frog   215 ARDEKASYVAWGHSTIVSPWGEVIAKAGSEETVI-SADIDLEYLAEIREQIPIRRQRRHDLYSV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 90/251 (36%)
FHIT 317..436 CDD:238606
nit2NP_001016633.2 nit 11..271 CDD:143596 90/251 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154369at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.