DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and hint1

DIOPT Version :10

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001005593.1 Gene:hint1 / 449551 ZFINID:ZDB-GENE-040927-8 Length:126 Species:Danio rerio


Alignment Length:115 Identity:29/115 - (25%)
Similarity:55/115 - (47%) Gaps:5/115 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 RSKEPTQDRPFATNIVDKR---TIFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMA 369
            :|.:|..|..|. .|:.|.   .|.||.:.|.||.::......|.||..::...::..::.|:..
Zfish     9 QSAQPGGDTIFG-KIIRKEIPANIIYEDDQCIAFNDVAPQAPTHFLVVPRKPISQISKVEDADKE 72

  Fly   370 DMFTTVCLVQRLLEKIYQTTSATVTVQDGAQAGQTVPHVHFHIM-PRRLG 418
            .:...:.:.::..|::.......:.|.||...||:|.|:|.|:: .|:||
Zfish    73 LLGHMMIVAKKCAEQVGLPRGYRLVVNDGPDGGQSVYHIHIHVLGGRQLG 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596
FHIT 317..436 CDD:238606 26/106 (25%)
hint1NP_001005593.1 PKCI_related 16..118 CDD:238607 24/102 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.