DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and CG8132

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster


Alignment Length:275 Identity:96/275 - (34%)
Similarity:156/275 - (56%) Gaps:15/275 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IAVGQMRSTSDKAANLSQVIELVDRA-KSQNACMLFLPECCDFVGESRTQTI-ELSEGL-DGELM 96
            :|:.|::.:.||.||:...:..::.| |.....::.||||  |.....|:.. |.||.: ||...
  Fly    10 LALLQLKGSKDKVANVQNAVTKIEAAVKEHKPRLITLPEC--FNAPYGTKYFREYSETIPDGYTS 72

  Fly    97 AQYRELAKCNKIWISLGGVHE--RNDQKIFNAHVLLNEKGELAAVYRKLHMFDVTTK-EVRLRES 158
            .|...||:.::::|..|.:.|  .|| .|:|...:.:..|:|.|.:||:|:||:..| .:|.:||
  Fly    73 QQLSNLARKHQVYIVGGTIPELGEND-AIYNTCTVWSPTGDLVAKHRKMHLFDIDVKGGIRFKES 136

  Fly   159 DTVTPG--YCLERPVSTPVGQIGLQICYDLRFAEPAVLLRKLGANLLTYPSAFTYATGKAHWEIL 221
            :|::.|  :.:   ::....:||:.||||:||.|.|.|.|..|..::.||:||...||..|||:|
  Fly   137 ETLSAGNDFTI---INVDGHKIGIGICYDIRFEEMARLYRNAGCEMIIYPAAFNMTTGPLHWELL 198

  Fly   222 LRARAIETQCFVVAAAQIGWHNQKRQSWGHSMIVSPWGNVLADCSEQELDIGTAEVDLSVLQSLY 286
            .|:||.:.|.|||..:.....:.:..::||||:|:||..|....||.| :|..|::|.|.::.:.
  Fly   199 QRSRANDNQLFVVTTSPARDTSAEYVAYGHSMVVNPWAKVQQSASEGE-EIVVADIDFSEVEQVR 262

  Fly   287 QTMPCFEHRRNDIYA 301
            |.:|.|..||.|:||
  Fly   263 QQIPVFGQRRLDLYA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 91/268 (34%)
FHIT 317..436 CDD:238606
CG8132NP_649888.1 nit 9..272 CDD:143596 91/268 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466370
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154369at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51442
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23088
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.