DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and pyd3

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_649732.1 Gene:pyd3 / 40916 FlyBaseID:FBgn0037513 Length:386 Species:Drosophila melanogaster


Alignment Length:235 Identity:49/235 - (20%)
Similarity:92/235 - (39%) Gaps:43/235 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CDFVGESRTQTIELSEGLDGELMAQYRELAKCNKIWISLGGVHER---NDQKIFNAHVLLNEKGE 135
            |:|..|:.          :|.......||||...: :.:..:.||   :.:.|:|..|:::..|.
  Fly   137 CEFAEEAE----------NGPTTKMLAELAKAYNM-VIIHSILERDMEHGETIWNTAVVISNSGR 190

  Fly   136 LAAVYRKLHM-----FDVTTKEVRLRESDTVTPGYCLERPVSTPVGQIGLQICYDLRFAEPAVLL 195
            ....:||.|:     |:.:|..:   |.:|..|.:      .|..|::.:.|||.....:..::.
  Fly   191 YLGKHRKNHIPRVGDFNESTYYM---EGNTGHPVF------ETEFGKLAVNICYGRHHPQNWMMF 246

  Fly   196 RKLGANLLTYPSAFTYATGKAHWEILLRARAIETQCFVVAAAQIGW---------------HNQK 245
            ...||.::..|||......:..|.|..|..||....|.|...::|.               |.:.
  Fly   247 GLNGAEIVFNPSATIGRLSEPLWSIEARNAAIANSYFTVPINRVGTEQFPNEYTSGDGNKAHKEF 311

  Fly   246 RQSWGHSMIVSPWGNVLADCSEQELDIGTAEVDLSVLQSL 285
            ...:|.|.:.:|.|:.....|..:..:...|:||::.:.:
  Fly   312 GPFYGSSYVAAPDGSRTPSLSRDKDGLLVVELDLNLCRQV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 49/235 (21%)
FHIT 317..436 CDD:238606
pyd3NP_649732.1 PLN00202 9..385 CDD:177792 49/235 (21%)
ML_beta-AS 9..372 CDD:143611 49/235 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466371
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.