DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and upb1

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_955910.1 Gene:upb1 / 322660 ZFINID:ZDB-GENE-030131-1380 Length:384 Species:Danio rerio


Alignment Length:225 Identity:51/225 - (22%)
Similarity:88/225 - (39%) Gaps:24/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FVGESRTQTIELSEGLDGELMAQY-RELAKCNKIWISLGGVHERND---QKIFNAHVLLNEKGEL 136
            |....|....|.:|..:..|..:: .:|||.:.: :.:..:.||::   ..::|..|:::..|.:
Zfish   127 FCTREREPWTEFAESAEDGLTTRFCIQLAKKHNM-VVVSPILERDEIHGGTLWNTAVVVSNNGNV 190

  Fly   137 AAVYRKLHMFDVTTKEVRLRESDTVTPGYCLERPVSTPVGQIGLQICYDLRFAEPAVLLRKLGAN 201
            ....||.|:..|..    ..||.....|....|...|..|:|.:.|||........::....||.
Zfish   191 LGKTRKNHIPRVGD----FNESTYYMEGNTGHRVFQTQFGKIAVNICYGRHHPLNWLMYSVNGAE 251

  Fly   202 LLTYPSAFTYATGKAHWEILLRARAIETQCFVVAAAQIGW---------------HNQKRQSWGH 251
            ::..|||......:..|.|..|..||...||..|..::|.               |:.....:|.
Zfish   252 IIFNPSATVGLLSEPMWPIEARNAAIANHCFTCAINRVGTEYFKNEFTSGDGKKAHHDFGHFYGS 316

  Fly   252 SMIVSPWGNVLADCSEQELDIGTAEVDLSV 281
            |.:.:|.|:.....|.....:..||:||::
Zfish   317 SYMAAPDGSRTPGLSRTRDGLLVAELDLNL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 51/225 (23%)
FHIT 317..436 CDD:238606
upb1NP_955910.1 PLN00202 6..384 CDD:177792 51/225 (23%)
ML_beta-AS 9..371 CDD:143611 51/225 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.