DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and vanin-like

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster


Alignment Length:147 Identity:37/147 - (25%)
Similarity:56/147 - (38%) Gaps:40/147 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 NDQKIFNAHVLLNEKGELAAVYRKLHMFDVTTKEVRLRESDTVTPGYCLERPVSTPVG-QIGLQI 182
            |...:||.:|:.:.:|.:.:.|||:|::........|.|..|          ..|..| ..|..|
  Fly   148 NGLNVFNTNVVFDRQGVVVSRYRKVHLYGEAKNSTFLPELIT----------FETDFGVTFGHFI 202

  Fly   183 CYDLRFAEPA-VLLRKLGANLLTYPSAFTYATGKAHWEILLRARAIETQCFVVAAAQIGWHNQKR 246
            |:|:.|..|| .|:.:.|.....||         |.|...|.        |:.|.       |.:
  Fly   203 CFDILFYTPAHQLIVEQGITDFVYP---------AMWFSQLP--------FLTAV-------QTQ 243

  Fly   247 QSWGHSMIVSPWGNVLA 263
            |.|.::..|    |:||
  Fly   244 QGWAYANDV----NLLA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 37/147 (25%)
FHIT 317..436 CDD:238606
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 37/147 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.