DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and Vnn1

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001020794.1 Gene:Vnn1 / 29142 RGDID:1310075 Length:512 Species:Rattus norvegicus


Alignment Length:443 Identity:86/443 - (19%)
Similarity:151/443 - (34%) Gaps:173/443 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 STSDKAANLSQVIELVD----RAKSQNACMLFLPE----------------------------CC 74
            |.|:..|.::|.::|::    .|..|.|.::..||                            .|
  Rat    47 SHSEALALMNQNLDLLEGAILSAAKQGAHIIVTPEDGIYGVQFTRDTIYPYLEDIPDPQVNWIPC 111

  Fly    75 DFVGESRTQTIELSEGLDGELMAQYRELAKCNKIWISLGGVHERNDQK---------------IF 124
            |  ...|..:..:.|.|..        |||.|.|::    |....|:|               .:
  Rat   112 D--NPERFGSTPVQERLSC--------LAKNNSIYV----VANMGDKKPCNTSDSHCPPDGRFQY 162

  Fly   125 NAHVLLNEKGELAAVYRKLHMFDVTTKEVRLRESDTVTPGYCLERPVSTPVGQIGLQICYDLRFA 189
            |..|:.:.:|:|.|.|.|.::|....:.....|.:.||        ..||.|:.|:..|:|:.|.
  Rat   163 NTDVVFDSRGKLVARYHKQNLFMGEEQFNAPPEPEVVT--------FDTPFGKFGIFTCFDILFH 219

  Fly   190 EPAV-LLRKLGANLLTYPSAFTYATGKAHW-EILLRARAIETQC---------FVVAAAQI---- 239
            :||| |:.:...:.:.:|:|         | ::|....|||...         |:.|...|    
  Rat   220 DPAVTLVTEFQVDTILFPTA---------WMDVLPHLAAIEFHSAWAIGMGVNFLAANLHIPLRR 275

  Fly   240 -------------GWHNQKRQSWGHSMIV--------SP--W----GNVLADCSEQE-------- 269
                         .:|..::...|..::.        ||  |    .:|.|..:|:|        
  Rat   276 MTGSGIYAPDSPRAFHYDRKTQEGKLLLAQLDSHPSHSPVNWTSYASSVEAPPTEKEEFRSFVFF 340

  Fly   270 -----LDIGTAEVDLSVLQS------LYQTMPCFEHRRNDIYALTAYNLRSKEPTQDRPFATNIV 323
                 :::.....:.:|.|:      .||..   |.|.:::|||.|::            ..:.|
  Rat   341 DEFTFVELKGITGNYTVCQNDLCCHLSYQMS---EKRADEVYALGAFD------------GLHTV 390

  Fly   324 DKRTIFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCG--LDCAEMA-DMFT 373
            :.:   |..:.|             :|:..|....|.||  :|.|... :||:
  Rat   391 EGQ---YHLQIC-------------ILLKCKTTNLRTCGSSVDTASTRFEMFS 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 69/361 (19%)
FHIT 317..436 CDD:238606 12/60 (20%)
Vnn1NP_001020794.1 biotinidase_like 27..324 CDD:143591 60/307 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.