DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and Nit2

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:XP_038944121.1 Gene:Nit2 / 288174 RGDID:1310494 Length:360 Species:Rattus norvegicus


Alignment Length:280 Identity:99/280 - (35%)
Similarity:154/280 - (55%) Gaps:11/280 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IAVGQMRSTSDKAANLSQVIELVDRAKSQNACMLFLPECCDFVGESRTQTI-ELSEGLDGELMAQ 98
            :|:.|::.:|.|:.|:::...||..|..|.|.::.||||  |.....|... |.:|.:.||...:
  Rat    90 LALIQLQVSSIKSDNITRACSLVREAAKQGANIVSLPEC--FNSPYGTNYFPEYAEKIPGESTKK 152

  Fly    99 YRELAKCNKIWISLGGVHERNDQKIFNAHVLLNEKGELAAVYRKLHMFDVTTK-EVRLRESDTVT 162
            ..|:||.|.|::..|.:.|.:|.|::|...:....|.|...:||:|:||:... ::..:||.|::
  Rat   153 LSEVAKENSIYLIGGSIPEEDDGKLYNTCAVFGPDGNLLVKHRKIHLFDIDVPGKITFQESKTLS 217

  Fly   163 PGYCLERPVSTPVGQIGLQICYDLRFAEPAVLLRKLGANLLTYPSAFTYATGKAHWEILLRARAI 227
            ||.... ...||..::||.||||:||||.|.:..:.|..||.||.||...||.||||:|.||||:
  Rat   218 PGDSFS-TFDTPYCRVGLGICYDMRFAELAQIYARRGCQLLVYPGAFNMTTGPAHWELLQRARAV 281

  Fly   228 ETQCFVVAAAQIGWHNQKRQSWGHSMIVSPWGNVLADCSEQELDIGTAEVDLSVLQSLYQTMPCF 292
            :.|.:|..|:..........:||||.:|.|||.||.....:| .|..:::||..|..:.|.:|..
  Rat   282 DNQVYVATASPARDEKASYVAWGHSTVVDPWGQVLTKAGTEE-TILYSDIDLKKLSEIRQQIPIL 345

  Fly   293 EHRRNDIYALTAYNLRSKEP 312
            :.:|.|:     |::.||:|
  Rat   346 KQKRADL-----YSVESKKP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 93/262 (35%)
FHIT 317..436 CDD:238606
Nit2XP_038944121.1 nit 89..349 CDD:143596 93/262 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154369at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.