DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and Vnn3

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_036109.3 Gene:Vnn3 / 26464 MGIID:1347055 Length:500 Species:Mus musculus


Alignment Length:443 Identity:87/443 - (19%)
Similarity:154/443 - (34%) Gaps:183/443 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LAKCNKIWI--SLGGVHERNDQK---------------IFNAHVLLNEKGELAAVYRKLHMFDVT 149
            |||.|.|:|  ::|      |:|               .:|.:|:.:.||.|.|.|.|.::|:  
Mouse   128 LAKENSIYIMANIG------DKKPCNATDPHCPPDGRYQYNTNVVFDSKGRLTARYHKYNLFE-- 184

  Fly   150 TKEVRL---RESDTVTPGYCLERPVSTPVGQIGLQICYDLRFAEPAVLL---------------- 195
             .|::.   ::|:.||        ..||.|:.|:..|:|:...:|||::                
Mouse   185 -PEIQFDFPKDSELVT--------FDTPFGKFGIFTCFDIFSYDPAVVVVKDTQVDSVLLPTAWY 240

  Fly   196 ----------------RKLGANLLTYPSAFT--YATGKA----------HWEI----------LL 222
                            |.:|.|:|...:..|  :.||..          |:::          .|
Mouse   241 NTLPLLSAVPFHSVWARAMGVNVLAANTHNTSMHMTGSGIYSPEAVRVYHYDMETESGQLLLSEL 305

  Fly   223 RARAIETQCFVVAAAQIGWHNQKRQSWGHSMIVSPWGNVLAD---------CSEQELDIGTAEVD 278
            |:|..:.    ...|::.|.       .::..|.|:.:..||         .|..:| .|:|. :
Mouse   306 RSRPRQH----ATPAEVNWS-------AYARTVKPFSSGQADFPGKIYFDEFSFTKL-TGSAG-N 357

  Fly   279 LSVLQS---LYQTMPCFEHRRNDIYALTAYN---------------LRSKEPTQDRPFATNIVDK 325
            .:|.|.   .:.|....|.|.:::|.|.|::               |...:.|..|.....:...
Mouse   358 YTVCQKDLCCHLTYKMSESRMDEVYVLGAFDGLHTVEGQYYLQICTLLKCQTTNSRTCGEPVGSA 422

  Fly   326 RTIFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMADMFTTVCLVQRLLEKIYQTTS 390
            .|.|.|......|             .||.|.|::. |..:::|            ||:.|:.: 
Mouse   423 FTKFEEFSLSGTF-------------RTKYVFPQIV-LSGSQLA------------LERYYEVS- 460

  Fly   391 ATVTVQDG---AQAGQTVPHVHFHIMPRRLGDFGHNDQIYVKLDERAEEKPPR 440
                 :||   ::.|..:|.:   :|           .:|.::.||   .|||
Mouse   461 -----RDGRLRSRGGAPLPIL---VM-----------ALYGRVFER---DPPR 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 56/279 (20%)
FHIT 317..436 CDD:238606 21/121 (17%)
Vnn3NP_036109.3 biotinidase_like 26..329 CDD:143591 45/228 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.