DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and SPAC26A3.11

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_594154.1 Gene:SPAC26A3.11 / 2542673 PomBaseID:SPAC26A3.11 Length:322 Species:Schizosaccharomyces pombe


Alignment Length:292 Identity:96/292 - (32%)
Similarity:157/292 - (53%) Gaps:30/292 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IAVGQMRSTSDKAANLSQV-IELVDRAKSQNACMLFLPEC-------------CDFVGESRTQTI 85
            |.:.|:.:|.||:.||... :::::.||: .:.::.|||.             .:.:.||.....
pombe    46 IGLVQLANTKDKSENLQLARLKVLEAAKN-GSNVIVLPEIFNSPYGTGYFNQYAEPIEESSPSYQ 109

  Fly    86 ELSEGLDGELMAQYRELAKCNKIWISLGGVHERNDQKIFNAHVLLNEKGELAAVYRKLHMFDVTT 150
            .||            .:||..|.::..|.:.||.|.|::|..::.:..|:|.||:||:|:||:..
pombe   110 ALS------------SMAKDTKTYLFGGSIPERKDGKLYNTAMVFDPSGKLIAVHRKIHLFDIDI 162

  Fly   151 K-EVRLRESDTVTPGYCLERPVSTPVGQIGLQICYDLRFAEPAVLLRKLGANLLTYPSAFTYATG 214
            . .|..||||:::||..:.. |.|..|:.||.||||:||.|.|::..:.|.:::.||.||..:||
pombe   163 PGGVSFRESDSLSPGDAMTM-VDTEYGKFGLGICYDIRFPELAMIAARNGCSVMIYPGAFNLSTG 226

  Fly   215 KAHWEILLRARAIETQCFVVAAAQIGWHNQKRQSWGHSMIVSPWGNVLADCSEQELDIGTAEVDL 279
            ..|||:|.||||::.:.||...|.....|....|||||.:|.|:|.|:|...|:. .|..|::|.
pombe   227 PLHWELLARARAVDNEMFVACCAPARDMNADYHSWGHSTVVDPFGKVIATTDEKP-SIVYADIDP 290

  Fly   280 SVLQSLYQTMPCFEHRRNDIYALTAYNLRSKE 311
            ||:.:...::|.:..||.|:|:.....|:.:|
pombe   291 SVMSTARNSVPIYTQRRFDVYSEVLPALKKEE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 90/275 (33%)
FHIT 317..436 CDD:238606
SPAC26A3.11NP_594154.1 nit 45..307 CDD:143596 90/275 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.