DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and SPCC965.09

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_588519.1 Gene:SPCC965.09 / 2539328 PomBaseID:SPCC965.09 Length:272 Species:Schizosaccharomyces pombe


Alignment Length:289 Identity:86/289 - (29%)
Similarity:137/289 - (47%) Gaps:46/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ATIAVGQMR-STSDKAANL----SQVIELVDRAKSQNACMLFLPEC------CDFVGESRTQTIE 86
            |.||..||. ...|...||    |.|.|:::...|.|  ::..||.      |   |.:.||..|
pombe     3 ANIACVQMAPKVCDVKHNLQKMSSYVHEVMESNPSTN--LILFPELITSGYEC---GNTFTQIAE 62

  Fly    87 LS-EGLDGELMAQYRELAKCNKIWISLGGVHERNDQK---IFNAHVLLNEKGELAAVYRKLHMFD 147
            :: ||...:.|:........|.|:    |..|:.:::   |:|:.:.:.|.|.|..||||:|:||
pombe    63 IAGEGPSFKTMSNLAAKYHVNIIY----GFPEKEEKQSNIIYNSCIYITENGNLGGVYRKVHLFD 123

  Fly   148 VTTKEVRLRESDTVTPGYCLERPV-STPVGQIGLQICYDLRFAEPAVLLRKLGANLLTYPSAF-- 209
            ...|..: :.||.         |: .|..|::|:.||:|..|.|.|.:....||:||...:.:  
pombe   124 TERKHFK-KGSDF---------PIFETSFGKLGVMICWDTAFPEVARIHALNGADLLVVATNWEN 178

  Fly   210 TYATGKAHWEILLRARAIETQCFVVAAAQIGWHNQKRQSWGHSMIVSPWGNVLADCSEQELDIGT 274
            .|:.   .|:::.:|||.|....:|||.::| .::|...:|||.|:.|.|.|:....|::..:.:
pombe   179 PYSD---DWDLVTKARAFENCIPLVAANRVG-TDEKLSFFGHSKIIGPTGKVIKALDEEKEGVIS 239

  Fly   275 AEVDL---SVLQSLYQTMPCFEHRRNDIY 300
            ..|||   ..|:..|.|.  ||.|..|:|
pombe   240 YTVDLDDAKPLRKNYYTF--FEDRMPDLY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 82/282 (29%)
FHIT 317..436 CDD:238606
SPCC965.09NP_588519.1 nitrilase 5..261 CDD:143587 82/280 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.