DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and aph1

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_587836.1 Gene:aph1 / 2539292 PomBaseID:SPCC4G3.02 Length:182 Species:Schizosaccharomyces pombe


Alignment Length:162 Identity:59/162 - (36%)
Similarity:92/162 - (56%) Gaps:31/162 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 IFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMADMFTTVCLVQRLLEKIYQTTSAT 392
            :||.::...||.||:.::.|||||..:|..|||..|..:|:.|:||:|..||:::||::..:::.
pombe    16 VFYRTKLSAAFVNLKPILPGHVLVIPQRAVPRLKDLTPSELTDLFTSVRKVQQVIEKVFSASASN 80

  Fly   393 VTVQDGAQAGQTVPHVHFHIMPRRLGDFGHNDQIYVKL--------------------DERA--- 434
            :.:|||..|||||||||.||:||:..||..||.:|.:|                    |||.   
pombe    81 IGIQDGVDAGQTVPHVHVHIIPRKKADFSENDLVYSELEKNEGNLASLYLTGNERYAGDERPPTS 145

  Fly   435 --------EEKPPRTIEERIEEAQIYRKFLTD 458
                    |::.|||:||..:|||..:.:.::
pombe   146 MRQAIPKDEDRKPRTLEEMEKEAQWLKGYFSE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596
FHIT 317..436 CDD:238606 50/138 (36%)
aph1NP_587836.1 FHIT 6..124 CDD:238606 47/107 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 94 1.000 Domainoid score I1977
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R813
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.