DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and Vnn1

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_035834.2 Gene:Vnn1 / 22361 MGIID:108395 Length:512 Species:Mus musculus


Alignment Length:264 Identity:64/264 - (24%)
Similarity:102/264 - (38%) Gaps:74/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 STSDKAANLSQVIELVD----RAKSQNACMLFLPECCDFVGESRTQTI--ELSEGLD-------- 92
            |.|:..|.::|.::|::    .|..|.|.::..||...:.......||  .|.|..|        
Mouse    47 SHSEALALMNQNLDLLEGAIVSAAKQGAHIIVTPEDGIYGVRFTRDTIYPYLEEIPDPQVNWIPC 111

  Fly    93 ------GELMAQYRE--LAKCNKIWISLGGVHERNDQK---------------IFNAHVLLNEKG 134
                  |....|.|.  |||.|.|::    |....|:|               .:|..|:.:.:|
Mouse   112 DNPKRFGSTPVQERLSCLAKNNSIYV----VANMGDKKPCNTSDSHCPPDGRFQYNTDVVFDSQG 172

  Fly   135 ELAAVYRKLHMFDVTTKEVRLRESDTVTPGYCLERPVSTPVGQIGLQICYDLRFAEPAV-LLRKL 198
            :|.|.|.|.::|....:.....|.:.||        ..||.|:.|:..|:|:.|.:||| |:.:.
Mouse   173 KLVARYHKQNIFMGEDQFNVPMEPEFVT--------FDTPFGKFGVFTCFDILFHDPAVTLVTEF 229

  Fly   199 GANLLTYPSAFTYATGKAHW-EILLRARAIETQC---------FVVAAAQIGWHNQKRQSWGHSM 253
            ..:.:.:|:|         | ::|....|||...         |:.|    ..||..|:..| |.
Mouse   230 QVDTILFPTA---------WMDVLPHLAAIEFHSAWAMGMGVNFLAA----NLHNPSRRMTG-SG 280

  Fly   254 IVSP 257
            |.:|
Mouse   281 IYAP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 64/264 (24%)
FHIT 317..436 CDD:238606
Vnn1NP_035834.2 biotinidase_like 27..324 CDD:143591 64/264 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.