DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and hint-1

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_492056.1 Gene:hint-1 / 184760 WormBaseID:WBGene00009002 Length:130 Species:Caenorhabditis elegans


Alignment Length:145 Identity:30/145 - (20%)
Similarity:57/145 - (39%) Gaps:26/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 AEVDLSVLQSLYQTMPCFEHRRNDIYALTAYNLRSKEPTQDRPFATNIVDKRTIFYESEHCFAFT 339
            :|||.:.|.::.:.:     :.||  .|....:|.:.|.:             |.:|.:...||.
 Worm     2 SEVDKAHLAAINKDV-----QAND--TLFGKIIRKEIPAK-------------IIFEDDEALAFH 46

  Fly   340 NLRCVVKGHVLVSTKR---VTPRLCGLDCAEMADMFTTVCLVQRLLEKIYQTTSATVTVQDGAQA 401
            ::......|.||..||   :.......|.|.:..:..|   ..::.:::.......|.|.:|...
 Worm    47 DVSPQAPIHFLVIPKRRIDMLENAVDSDAALIGKLMVT---ASKVAKQLGMANGYRVVVNNGKDG 108

  Fly   402 GQTVPHVHFHIMPRR 416
            .|:|.|:|.|::..|
 Worm   109 AQSVFHLHLHVLGGR 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 4/20 (20%)
FHIT 317..436 CDD:238606 21/103 (20%)
hint-1NP_492056.1 PKCI_related 20..122 CDD:238607 24/119 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.