DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NitFhit and upb-1

DIOPT Version :9

Sequence 1:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_495261.1 Gene:upb-1 / 174040 WormBaseID:WBGene00017440 Length:387 Species:Caenorhabditis elegans


Alignment Length:324 Identity:75/324 - (23%)
Similarity:121/324 - (37%) Gaps:51/324 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QLRRMSVQKRKDQS--------ATIAVGQMRSTSDKAANLSQVIE-----LVDRAKSQNACMLFL 70
            ||....|..:|:|:        |.|.....|.|:|........|.     :::.|.|..|.::.|
 Worm    55 QLSGYIVDAQKEQTRAPRLVRVAAIQNKIHRPTTDSVVEQRDAIHQRVGAMIEAAASAGANVIGL 119

  Fly    71 PECCD----FVGESRTQTIELSEGL-DGELMAQYRELAKCNKIWISLGGVHERNDQK---IFNAH 127
            .|...    |....|....|.:|.: .|.......:||..:.| :.:..:.||:::|   |:|..
 Worm   120 QEAWTMPFAFCTRERLPWTEFAESVYTGPTTQFLSKLAVKHDI-VIISPILERDEEKDDVIWNTA 183

  Fly   128 VLLNEKGELAAVYRKLHMFDVTTKEVRLRESDTVTPGYCLERPVSTPV-----GQIGLQICYDLR 187
            |:::..|.:....||.|:         .|..|.....|.:|..:..||     |:||:.|||...
 Worm   184 VVISHTGRVIGRSRKNHI---------PRVGDFNESTYYMESTLGHPVFETKYGRIGINICYGRH 239

  Fly   188 FAEPAVLLRKLGANLLTYPSAFTYATGKAHWEILLRARAIETQCFVVAAAQIGW----------- 241
            ..:..::....||.::..|||...|..:..|.|..|..||....|.|...::|.           
 Worm   240 HPQNWMMYALNGAEIIFNPSATVGALSEPLWGIEARNAAIANHVFTVGINRVGTEVFPNEFTSGN 304

  Fly   242 ----HNQKRQSWGHSMIVSPWGNVLADCSEQELDIGTAEVDLSVLQSLYQTMPCFEHRRNDIYA 301
                |......:|.|.|.:|.|:.....|.....:..||:||::.:............|.|:||
 Worm   305 GQPAHKDFGHFYGSSYIAAPDGSRTPALSRVREGVLIAELDLNLCRQCKDAWGFRMTNRLDMYA 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NitFhitNP_525122.1 nit 34..296 CDD:143596 65/294 (22%)
FHIT 317..436 CDD:238606
upb-1NP_495261.1 ML_beta-AS 11..373 CDD:143611 75/324 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.