powered by:
Protein Alignment NitFhit and nit1
DIOPT Version :10
| Alignment Length: | 74 |
Identity: | 15/74 - (20%) |
| Similarity: | 25/74 - (33%) |
Gaps: | 31/74 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 126 LPHE---------DLKSEPRYLA----------TFTVGINQKANIDA-----C-------VKKFS 159
:||. ||:.:|:.|| |:..|:.....|.| | :|...
Frog 123 MPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVF 187
Fly 160 ENFTIVLFH 168
:...:.:||
Frog 188 DEAILTIFH 196
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| NitFhit | NP_525122.1 |
nit |
34..296 |
CDD:143596 |
15/74 (20%) |
| FHIT |
317..436 |
CDD:238606 |
|
| nit1 | XP_002943158.2 |
nit |
8..275 |
CDD:143596 |
15/74 (20%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Return to query results.
Submit another query.