DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mri and Kctd6

DIOPT Version :9

Sequence 1:NP_612008.1 Gene:mri / 38028 FlyBaseID:FBgn0035107 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001292865.1 Gene:Kctd6 / 71393 MGIID:1918643 Length:237 Species:Mus musculus


Alignment Length:101 Identity:31/101 - (30%)
Similarity:50/101 - (49%) Gaps:11/101 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 ITMLVDGVRFTVEQSLLTAHPTTMLGTMFGSGFQFAHTNERGEYDV-ADGISHLVFRAILEYYKS 161
            :|:.|.|..:|...:.||.:|.:|||.|||..|..|. :.:|.|.: .||   .:||.:|.:.::
Mouse    14 VTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTAR-DPQGNYFIDRDG---PLFRYVLNFLRT 74

  Fly   162 GVIRCPPTVSVPEL--KEACDYLLIPFDATTVRCQN 195
            ..:..|......:|  |||..|.:.|.    ::|.|
Mouse    75 SELTLPLDFKEFDLLRKEADFYQIEPL----IQCLN 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mriNP_612008.1 BTB 98..199 CDD:197585 31/101 (31%)
BTB_3 128..357 CDD:292636 18/71 (25%)
Kctd6NP_001292865.1 Interaction with ANK1 isoform Mu7. /evidence=ECO:0000250|UniProtKB:Q8NC69 1..104 29/97 (30%)
BTB_POZ 10..113 CDD:365784 31/101 (31%)
Interaction with CUL3. /evidence=ECO:0000250|UniProtKB:Q8NC69 10..110 31/101 (31%)
Interaction with USP21. /evidence=ECO:0000250|UniProtKB:Q8NC69 113..187
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.