powered by:
Protein Alignment mri and Btbd10
DIOPT Version :10
| Sequence 1: | NP_612008.1 |
Gene: | mri / 38028 |
FlyBaseID: | FBgn0035107 |
Length: | 439 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_006508222.1 |
Gene: | Btbd10 / 68815 |
MGIID: | 1916065 |
Length: | 483 |
Species: | Mus musculus |
| Alignment Length: | 36 |
Identity: | 8/36 - (22%) |
| Similarity: | 12/36 - (33%) |
Gaps: | 16/36 - (44%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 747 CDEQEDLETK----------------DEEDSLKLGK 766
||.:||..|: .:|..:..||
Mouse 185 CDSKEDPATRVGLPYKPSTVVTARATSDESDVSFGK 220
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| mri | NP_612008.1 |
BTB_3 |
97..200 |
CDD:464976 |
|
| Btbd10 | XP_006508222.1 |
BTB_POZ_BTBD10_GMRP1 |
173..282 |
CDD:349693 |
8/36 (22%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Return to query results.
Submit another query.
