DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mri and kctd6b

DIOPT Version :9

Sequence 1:NP_612008.1 Gene:mri / 38028 FlyBaseID:FBgn0035107 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001002329.1 Gene:kctd6b / 436601 ZFINID:ZDB-GENE-040718-14 Length:237 Species:Danio rerio


Alignment Length:191 Identity:47/191 - (24%)
Similarity:76/191 - (39%) Gaps:43/191 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RLPLPPERITMLVDGVRFTVEQSLLTAHPTTMLGTMFGSGFQFAHTNERGEYDV-ADGISHLVFR 153
            ||..|   :|:.|.|..:|...|.|..:|.:|||.||...|.... :.:|.|.: .||   .:||
Zfish     9 RLTHP---VTLNVGGHLYTTSISTLQRYPDSMLGAMFRGDFPTTR-DAQGNYFIDRDG---TLFR 66

  Fly   154 AILEYYKSGVIRCPPTVSVPEL----KEACDYLLIPFDATTVRCQNLRGLLH---------ELSN 205
            .||.:.::..:..|  |...||    |||..|.:.|.    ::|.|....|:         |||:
Zfish    67 YILNFLRTSELTLP--VDFTELDLLRKEADFYQIEPL----IQCLNDPKPLYPLDTFEQVVELSS 125

  Fly   206 EGARQQFE----LFLEDLILPLMVASAQRGDRECHVVVLLEDDMVEWDEEFPPQMGEEYCQ 262
            .....::.    :.:..|.:...|.|...|         :.::..:|::.   .|....||
Zfish   126 TRKLSKYSNPVAVIITQLTITTKVHSLLEG---------ISNNFTKWNKH---MMDTRDCQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mriNP_612008.1 BTB 98..199 CDD:197585 32/105 (30%)
BTB_3 128..357 CDD:292636 32/153 (21%)
kctd6bNP_001002329.1 BTB 14..104 CDD:197585 30/99 (30%)
BTB 14..102 CDD:295341 30/97 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.