DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mri and KCTD11

DIOPT Version :9

Sequence 1:NP_612008.1 Gene:mri / 38028 FlyBaseID:FBgn0035107 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001350571.1 Gene:KCTD11 / 147040 HGNCID:21302 Length:271 Species:Homo sapiens


Alignment Length:149 Identity:39/149 - (26%)
Similarity:60/149 - (40%) Gaps:22/149 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PPE---RITMLVDGVRFTVEQSLLTAHPTTMLGTMFGSGFQF---AHTNERGEYDV-ADGISHLV 151
            ||.   .:|:.|.|..::.....||..|.:|||.||.:|...   .::...|.|.: .||   ..
Human    10 PPSFGGPVTLNVGGTLYSTTLETLTRFPDSMLGAMFRAGTPMPPNLNSQGGGHYFIDRDG---KA 71

  Fly   152 FRAILEYYKSGVIRCPPTVSVPELKEACDYLLIPFDATTVRCQNLRGLLHEL-SNEGARQQFELF 215
            ||.||.:.:.|.:..|.......|..|        :|...:.:.|...|.|| :::|........
Human    72 FRHILNFLRLGRLDLPRGYGETALLRA--------EADFYQIRPLLDALRELEASQGTPAPTAAL 128

  Fly   216 LE---DLILPLMVASAQRG 231
            |.   |:...|:..||:||
Human   129 LHADVDVSPRLVHFSARRG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mriNP_612008.1 BTB 98..199 CDD:197585 26/104 (25%)
BTB_3 128..357 CDD:292636 26/112 (23%)
KCTD11NP_001350571.1 BTB 17..109 CDD:321966 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.