DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rno and Kdm4d

DIOPT Version :9

Sequence 1:NP_001246528.1 Gene:rno / 38027 FlyBaseID:FBgn0035106 Length:3241 Species:Drosophila melanogaster
Sequence 2:NP_001073180.1 Gene:Kdm4d / 689582 RGDID:1591045 Length:510 Species:Rattus norvegicus


Alignment Length:244 Identity:52/244 - (21%)
Similarity:83/244 - (34%) Gaps:56/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  2681 SKTSTSDARSQIKLKIKSPMAYPEHYNAMTNSSSLTLTSTLVQSSNVVQTT---VSTSTVVSASS 2742
            |:.|..:||....:.....:..||.|........    ..:|..:..:..|   ::|..|:.|..
  Rat   305 SQCSCGEARVSFSMDAFVRILQPERYEMWKRGQD----QAVVDHTEAMGPTSQELTTWRVIQAPR 365

  Fly  2743 AVSGNSRRMRKKELLSLYVVQKDNHNDDSSCGLPAASDTLPLENLRKSEEEDELSGGNGTKRFKK 2807
            ...| .:.:|.:::              |.|.||.|:|:....|.:...          |.|...
  Rat   366 KTWG-LKHLRLRQV--------------SRCLLPVATDSNIANNTQMCH----------TSRQAA 405

  Fly  2808 NSSSRELRALDANLALVEEQLLSSGAGACGGGSSGDGRRRSACSSGSNNDNNGKTGAASSAGKRR 2872
            :|...|::..|..:|......||| .|....|..|.|||  .|..|.....||      :..|||
  Rat   406 DSKGDEVQESDPAIAPPYPLGLSS-PGHMSTGKRGLGRR--PCELGVQESTNG------APVKRR 461

  Fly  2873 GRSKTLESSEDDHQAPKLKIKIRGLT---------ANETPSGVSSVDEG 2912
                 |....|| ::|..:::.:.:|         .|..|....:..||
  Rat   462 -----LPEGRDD-RSPSPELQSQSVTGDLIVNSDLVNPGPQHPVTASEG 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnoNP_001246528.1 COG5141 250..>664 CDD:227470
EPL1 <250..288 CDD:287484
PHD_JADE 314..359 CDD:277048
ePHD_RNO 367..480 CDD:277177
TFIIA 2138..>2295 CDD:281188
Kdm4dNP_001073180.1 JmjN 15..55 CDD:128818
JmjC 176..292 CDD:202224
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..510 31/133 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.