DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rno and KDM4D

DIOPT Version :9

Sequence 1:NP_001246528.1 Gene:rno / 38027 FlyBaseID:FBgn0035106 Length:3241 Species:Drosophila melanogaster
Sequence 2:NP_060509.2 Gene:KDM4D / 55693 HGNCID:25498 Length:523 Species:Homo sapiens


Alignment Length:266 Identity:51/266 - (19%)
Similarity:78/266 - (29%) Gaps:133/266 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly  1227 KRGR--------PPKVP--------KDARPPSITENDKPALPTHTQSKPPSVVATPVSAKS---- 1271
            |||:        .|:||        |:.:.|.........||:|.....|    .|::|:|    
Human   337 KRGQDRAVVDHMEPRVPASQELSTQKEVQLPRRAALGLRQLPSHWARHSP----WPMAARSGTRC 397

  Fly  1272 -NFAVSLVPQRQAAKKAAEQLK------SSKPVLESFSTGNDISDKETVTSATISGSGSSVPAAS 1329
             ....|.:|:|.|....|.|.:      |.||                      |.:.||.|..|
Human   398 HTLVCSSLPRRSAVSGTATQPRAAAVHSSKKP----------------------SSTPSSTPGPS 440

  Fly  1330 TPVKPTRRSSIKEAPITPKEPLSGRR---------KSKEDLLATPIKTTPLVKRRVVVPNLSSSS 1385
            ..:               ..|.:|||         :::|..|.||.| .||:             
Human   441 AQI---------------IHPSNGRRGRGRPPQKLRAQELTLQTPAK-RPLL------------- 476

  Fly  1386 SGDSESSSSSSSSGSSSSSGGSDSDSESQASNSENPSSREPPVAPAKVPSDSSLVPKRSPRKSMD 1450
                        :|::.::.|.:                     |..:|.|.:|         ||
Human   477 ------------AGTTCTASGPE---------------------PEPLPEDGAL---------MD 499

  Fly  1451 KPSALT 1456
            ||..|:
Human   500 KPVPLS 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnoNP_001246528.1 COG5141 250..>664 CDD:227470
EPL1 <250..288 CDD:287484
PHD_JADE 314..359 CDD:277048
ePHD_RNO 367..480 CDD:277177
TFIIA 2138..>2295 CDD:281188
KDM4DNP_060509.2 JmjN 19..53 CDD:280526
JmjC 179..295 CDD:202224
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..523 34/192 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.