DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtch and YIA6

DIOPT Version :9

Sequence 1:NP_001246525.1 Gene:Mtch / 38026 FlyBaseID:FBgn0027786 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_012260.1 Gene:YIA6 / 854811 SGDID:S000001268 Length:373 Species:Saccharomyces cerevisiae


Alignment Length:251 Identity:56/251 - (22%)
Similarity:99/251 - (39%) Gaps:58/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLRLGVSAALHPFEYSKTLIQL-GYEPIAPLP-GKSILGKPIMKLPNIFQYAGHIRRIDGFYGCY 84
            |...||  |:.|.:.:||.:|. |.:.....| .:.|:|.           ...|.|.:|..|.|
Yeast    88 GFLSGV--AVCPLDVAKTRLQAQGLQTRFENPYYRGIMGT-----------LSTIVRDEGPRGLY 139

  Fly    85 RGLAPKLVGSLVAMVVSDRVADQLGLEQPEENKDDSQLSDEELYVQFKKSLKRDIVLMVSGVVA- 148
            :||.|.::|.....::...|            .:.|:.....::.|| ..:.:....:.:|..: 
Yeast   140 KGLVPIVLGYFPTWMIYFSV------------YEFSKKFFHGIFPQF-DFVAQSCAAITAGAAST 191

  Fly   149 --SHPFHVISLRMMAQF-VGRE-TLYTSIVGSVAEIWKSEGIAGFFAGLVPKLLG---------- 199
              ::|..|:..|:|.|. :|.. |.|.....:..:::..||....:|||||.|||          
Yeast   192 TLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFHVAIHFPI 256

  Fly   200 --DLA----CLVLSSSTIYI-LNKYIIKDKLGRQYNSGFTQFAVSSLLYPLQVVST 248
              ||.    |....::|..| |.:.|:.        |..::...|::.||.:::.|
Yeast   257 YEDLKVRFHCYSRENNTNSINLQRLIMA--------SSVSKMIASAVTYPHEILRT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtchNP_001246525.1 Mito_carr 142..222 CDD:278578 26/101 (26%)
YIA6NP_012260.1 Mito_carr 75..171 CDD:395101 23/107 (21%)
Mito_carr 176..268 CDD:395101 22/91 (24%)
Mito_carr 274..365 CDD:395101 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3768
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.