DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtch and RIM2

DIOPT Version :9

Sequence 1:NP_001246525.1 Gene:Mtch / 38026 FlyBaseID:FBgn0027786 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_009751.1 Gene:RIM2 / 852491 SGDID:S000000396 Length:377 Species:Saccharomyces cerevisiae


Alignment Length:189 Identity:45/189 - (23%)
Similarity:81/189 - (42%) Gaps:40/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SAALHPFEYSKTLIQLGYEPIAPLPGKSILGKPIMKLPNIFQYAGHIRRIDGFYGCYRGLAPKLV 92
            :.|.:|....||.:||      ...||:    .:.:..|.:.....:.|.:||.|.|:||:...:
Yeast   190 ATATNPIWLIKTRVQL------DKAGKT----SVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYL 244

  Fly    93 GSL-----------VAMVVSDRVADQLGLEQPEENKDDSQLSDEELYVQFKKSLKRDIVLMVSGV 146
            ||:           :..::.:|..::.|. |.|..|..|    |::....::|....:...|:. 
Yeast   245 GSVEGILQWLLYEQMKRLIKERSIEKFGY-QAEGTKSTS----EKVKEWCQRSGSAGLAKFVAS- 303

  Fly   147 VASHPFHVISLRMMAQFVGRET-------LYTSIVGSVAEIWKSEGIAGFFAGLVPKLL 198
            :|::|..|:..|:      |:|       .||.:|.|...|.|.||:...::||.|.|:
Yeast   304 IATYPHEVVRTRL------RQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLM 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtchNP_001246525.1 Mito_carr 142..222 CDD:278578 19/64 (30%)
RIM2NP_009751.1 PTZ00169 <72..264 CDD:240302 18/83 (22%)
Mito_carr 294..377 CDD:395101 19/70 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.