DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtch and mtch2

DIOPT Version :9

Sequence 1:NP_001246525.1 Gene:Mtch / 38026 FlyBaseID:FBgn0027786 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_989114.1 Gene:mtch2 / 394719 XenbaseID:XB-GENE-997514 Length:298 Species:Xenopus tropicalis


Alignment Length:275 Identity:100/275 - (36%)
Similarity:153/275 - (55%) Gaps:6/275 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LRLGVSAALHPFEYSKTLIQLGYEPIAPLPGKSILGKPIMKLPNIFQYAGHIRRIDGFYGCYRGL 87
            |..|::...||..|.|.|:|:|:||:.|..|:::.|:.:.:||.:|.||.||..|||..|.::||
 Frog    10 LGAGLTVLSHPMMYVKVLVQVGHEPLPPTLGRNLFGRQVYQLPGLFSYAKHIISIDGKSGLFKGL 74

  Fly    88 APKLVGSLVAMVVSDRVADQLGLEQPEENKDDSQLSDEELYVQFKKSLKRDIVLMVSGVVASHPF 152
            .|:|....:..||...|..  ..:.|..:::..|...........|...:::|...:..:.:||.
 Frog    75 VPRLCAGAIGTVVHSHVLQ--NYQDPNSSEESEQKDSSASLDLIVKETTQEMVARSAAALVTHPL 137

  Fly   153 HVISLRMMAQFVGRETLYTSIVGSVAEIWKSEGIAGFFAGLVPKLLGDLACLVLSSSTIYILNKY 217
            |||:||.|.||:||||.|:.:.||:..|::.|||.|||||.:|:||||:..|.:.:...|::|||
 Frog   138 HVITLRCMVQFIGRETKYSGVFGSIVTIYREEGILGFFAGFIPRLLGDIFSLWICNMAAYLINKY 202

  Fly   218 IIKDKLG----RQYNSGFTQFAVSSLLYPLQVVSTCSAVSGSRLMAAQPPIMPAYRNWVDCWNDL 278
            .:::...    :.|:..||.|..|.|.||..:||...||:...|....||....|.:|:|||..|
 Frog   203 ALENGASGGEMKSYSRAFTGFLASILTYPFVLVSNIMAVNNCGLAGGLPPYAAPYTSWIDCWTQL 267

  Fly   279 QVRGELKRGSSLFWR 293
            ...|.:.||:|||:|
 Frog   268 SKEGNMNRGNSLFFR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtchNP_001246525.1 Mito_carr 142..222 CDD:278578 36/79 (46%)
mtch2NP_989114.1 Mito_carr 124..>186 CDD:365909 31/61 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H8645
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1439019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10863
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.