DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtch and CG10920

DIOPT Version :9

Sequence 1:NP_001246525.1 Gene:Mtch / 38026 FlyBaseID:FBgn0027786 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_572408.2 Gene:CG10920 / 31688 FlyBaseID:FBgn0029963 Length:397 Species:Drosophila melanogaster


Alignment Length:291 Identity:116/291 - (39%)
Similarity:174/291 - (59%) Gaps:12/291 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EHARAEDTEVNVWIRFGLRLGVSAALHPFEYSKTLIQLGYEPI--APLPGKSILGKPIMKLPNIF 68
            ||.|.     |..:||.||||.:..|:|:|.:|.|||||:||:  .|...:.|..:|.:.||::.
  Fly    99 EHRRP-----NQLVRFCLRLGYNTLLYPYEMAKVLIQLGHEPLQAKPFVMRLIQRRPRLFLPSVH 158

  Fly    69 QYAGHIRRIDGFYGCYRGLAPKLVGSLVAMVVSDRVADQLGLEQPEENKDDSQLSDEELYVQFKK 133
            :|..||:.|||:.|.||||..:|..|:|..::.|.:...|.. .|.:......||.:|    |..
  Fly   159 RYVQHIQHIDGYTGMYRGLTARLAASIVDYLLGDLLLATLHF-APYKRGPKEGLSLKE----FWW 218

  Fly   134 SLKRDIVLMVSGVVASHPFHVISLRMMAQFVGRETLYTSIVGSVAEIWKSEGIAGFFAGLVPKLL 198
            :|.|:.:.:.:.||.:|||:|:.:|.:|||||.|.:|..:|||:..:.:.||.||.|||:||:||
  Fly   219 NLTRNSLRITTVVVITHPFYVVMVRQIAQFVGGEHVYEGLVGSLMTLAQQEGCAGLFAGMVPRLL 283

  Fly   199 GDLACLVLSSSTIYILNKYIIKDKLGRQYNSGFTQFAVSSLLYPLQVVSTCSAVSGSRLMAAQPP 263
            |:.:.|.::|:..::..:.:...:|..|||:...|...|.:.|||:|.|||.|.:|:.|.|.:||
  Fly   284 GEWSVLFITSALSHLCRRLLPMSELQHQYNTAVIQMMASLVAYPLEVTSTCMAGTGAPLTACEPP 348

  Fly   264 IMPAYRNWVDCWNDLQVRGELKRGSSLFWRS 294
            .||.|.:||||..||..||...||:.||||:
  Fly   349 SMPLYNHWVDCLTDLYARGGQNRGAILFWRT 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtchNP_001246525.1 Mito_carr 142..222 CDD:278578 31/79 (39%)
CG10920NP_572408.2 Mito_carr 231..>284 CDD:278578 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462131
Domainoid 1 1.000 56 1.000 Domainoid score I11003
eggNOG 1 0.900 - - E1_KOG2745
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3153
Isobase 1 0.950 - 0 Normalized mean entropy S3768
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1439019at2759
OrthoFinder 1 1.000 - - FOG0004199
OrthoInspector 1 1.000 - - otm26134
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10780
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.