powered by:
Protein Alignment Mtch and F43E2.11
DIOPT Version :9
Sequence 1: | NP_001246525.1 |
Gene: | Mtch / 38026 |
FlyBaseID: | FBgn0027786 |
Length: | 316 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379636.1 |
Gene: | F43E2.11 / 185711 |
WormBaseID: | WBGene00018397 |
Length: | 114 |
Species: | Caenorhabditis elegans |
Alignment Length: | 60 |
Identity: | 19/60 - (31%) |
Similarity: | 30/60 - (50%) |
Gaps: | 2/60 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 ALHPFEYSKTLIQLGYEPIAPLPGKSIL--GKPIMKLPNIFQYAGHIRRIDGFYGCYRGL 87
::||....:.|||.||||.....|:..: |:.:..||||..|...:.:...|...::||
Worm 3 SVHPITVVRELIQFGYEPFPTTCGRKYIFFGEEMAILPNILSYMKQLSKAKKFSTLFKGL 62
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Mtch | NP_001246525.1 |
Mito_carr |
142..222 |
CDD:278578 |
|
F43E2.11 | NP_001379636.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160164055 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1439019at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004199 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R10863 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X4015 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.880 |
|
Return to query results.
Submit another query.