DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtch and F43E2.11

DIOPT Version :9

Sequence 1:NP_001246525.1 Gene:Mtch / 38026 FlyBaseID:FBgn0027786 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001379636.1 Gene:F43E2.11 / 185711 WormBaseID:WBGene00018397 Length:114 Species:Caenorhabditis elegans


Alignment Length:60 Identity:19/60 - (31%)
Similarity:30/60 - (50%) Gaps:2/60 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ALHPFEYSKTLIQLGYEPIAPLPGKSIL--GKPIMKLPNIFQYAGHIRRIDGFYGCYRGL 87
            ::||....:.|||.||||.....|:..:  |:.:..||||..|...:.:...|...::||
 Worm     3 SVHPITVVRELIQFGYEPFPTTCGRKYIFFGEEMAILPNILSYMKQLSKAKKFSTLFKGL 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtchNP_001246525.1 Mito_carr 142..222 CDD:278578
F43E2.11NP_001379636.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1439019at2759
OrthoFinder 1 1.000 - - FOG0004199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10863
SonicParanoid 1 1.000 - - X4015
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.