DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13875 and RASSF9

DIOPT Version :9

Sequence 1:NP_001261185.1 Gene:CG13875 / 38024 FlyBaseID:FBgn0035104 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_005438.2 Gene:RASSF9 / 9182 HGNCID:15739 Length:435 Species:Homo sapiens


Alignment Length:445 Identity:99/445 - (22%)
Similarity:176/445 - (39%) Gaps:98/445 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LPSQSESFSIWVNGEEHWISGADSSTTCADLICALISYQI----DQKHVLSKEEILAPQQFAIVQ 75
            :.|:.:...:||..||..:.|....||.||:|.||:....    :::.:|.|     |..:.|::
Human    22 MDSEEKEIVVWVCQEEKLVCGLTKRTTSADVIQALLEEHEATFGEKRFLLGK-----PSDYCIIE 81

  Fly    76 KQRHYEEYLDSSARLLDVITS-----PH---AMPKEEYQLHLRHLATSSRKQVPTTDKDSGMGSP 132
            |.|..|..|....|:|.:..:     |:   .:.|.:..|.:....|:..|.|..|:|...: ||
Human    82 KWRGSERVLPPLTRILKLWKAWGDEQPNMQFVLVKADAFLPVPLWRTAEAKLVQNTEKLWEL-SP 145

  Fly   133 VDSSRSMRIRRRGKLLSTKTTDNINTKQSKRSRKQQQRNHHLTPNESLLTIILAQDETILQQMTM 197
            .:..:::...::.:::.       .|.:.....||...:|.....|:|:.:|::||.||.||:..
Human   146 ANYMKTLPPDKQKRIVR-------KTFRKLAKIKQDTVSHDRDNMETLVHLIISQDHTIHQQVKR 203

  Fly   198 LHEKDRQIFKIEEEKHQVRERELGKNYLLETYLKDLDEPQEKGEDLELFEEMTHIDVDRDFGIMS 262
            :.|.|.:|.|.|.:.|..|....|:||:.:.||.......|:..||:..|..|..|:....||..
Human   204 MKELDLEIEKCEAKFHLDRVENDGENYVQDAYLMPSFSEVEQNLDLQYEENQTLEDLSESDGIEQ 268

  Fly   263 DSTVQTALNSGTMQDDIRLY--WLEKIH-EVNKE---------------------------LQCE 297
                        :::.::.|  .::|:. |:.||                           ::|:
Human   269 ------------LEERLKYYRILIDKLSAEIEKEVKSVCIDINEDAEGEAASELESSNLESVKCD 321

  Fly   298 EELL----LSLHSKVRRHQVKRAYQTKSEVLLQIERLDTELATQVADIHHVERKLFTANEQLKAK 358
            .|..    |.:||.:...|.:..|   |:.|||::..:.||..:..:..|:..|   ...|||  
Human   322 LEKSMKAGLKIHSHLSGIQKEIKY---SDSLLQMKAKEYELLAKEFNSLHISNK---DGCQLK-- 378

  Fly   359 LAVLECLSREFETTVSGGV---------------QEGDVATGSNASAKVQQSQSD 398
                |..::|.|...|.|.               .:.|....||.|...:.:..|
Human   379 ----ENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDSDTGISSNHSQDSETTVGD 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13875NP_001261185.1 None
RASSF9NP_005438.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 99/445 (22%)
RA_RASSF9 28..120 CDD:340550 24/96 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..435 9/50 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147069
Domainoid 1 1.000 69 1.000 Domainoid score I9661
eggNOG 1 0.900 - - E1_KOG1574
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5331
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003658
OrthoInspector 1 1.000 - - otm42175
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15286
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3544
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.