DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13875 and AT5G59390

DIOPT Version :9

Sequence 1:NP_001261185.1 Gene:CG13875 / 38024 FlyBaseID:FBgn0035104 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001318837.1 Gene:AT5G59390 / 836058 AraportID:AT5G59390 Length:561 Species:Arabidopsis thaliana


Alignment Length:282 Identity:52/282 - (18%)
Similarity:111/282 - (39%) Gaps:74/282 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 QKQRHYEEYLDSSARLLDVITSPHAMPKEEYQLHLRHLATSSR---KQVPTTDKDSGMGSPVDSS 136
            |.::..|:.:|.::|.|:.:...:.:..:.||...:.:.....   :||  .|......:.:::.
plant   188 QSKQELEQKVDETSRFLESLELHNVLLNKNYQEGFQKMQMKMEELYQQV--LDGHEKSLAELEAK 250

  Fly   137 RSMRIRRRGKLLSTKTTDNINTKQSKRSRKQQQRNHHLTPNESLLTIILAQDETILQQMTMLHEK 201
            |. ::..|.:|:..:..  ||.::.::||.:::.|.                    :.|...:|.
plant   251 RE-KLDERARLIEQRAI--INEEEMEKSRLEREMNQ--------------------KAMCEQNEA 292

  Fly   202 DRQIFKIEEEKHQ----VRERELGKNYLLETYLKDLDEPQEKGEDLELFEEMTHI-------DVD 255
            :.:..|: .||||    ::|:|.....::|...| |:|.||...::|..:..|::       |.|
plant   293 NEEAMKL-AEKHQASSSLKEKEKLHKRIMEMEAK-LNETQELELEIEKLKGTTNVMKHMVGSDGD 355

  Fly   256 RDFGIMSDSTVQTALNSGTMQDDIRLYWLEKIHEVNKELQCEEELLLSLHSKV-----RRHQVKR 315
            :|.                         :|||.:...:|..:|   .:||.|:     :......
plant   356 KDI-------------------------VEKIAKTQIQLDAQE---TALHEKMMTLARKERATND 392

  Fly   316 AYQTKSEVLLQIERLDTELATQ 337
            .||...:.::|:...:.||..|
plant   393 EYQDVLKEMIQVWNANEELMKQ 414



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.