DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13875 and RASSF7

DIOPT Version :9

Sequence 1:NP_001261185.1 Gene:CG13875 / 38024 FlyBaseID:FBgn0035104 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_003466.1 Gene:RASSF7 / 8045 HGNCID:1166 Length:373 Species:Homo sapiens


Alignment Length:384 Identity:77/384 - (20%)
Similarity:120/384 - (31%) Gaps:128/384 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLPSQSESFSIWVNGEEHWISGADSSTTCADLICALISYQIDQKHVLSKEEILAPQQFAIVQKQR 78
            ||...:....:||:|.:..:.|....|||.:::.||            .:.|....:|.:||:.|
Human     2 LLGLAAMELKVWVDGIQRVVCGVSEQTTCQEVVIAL------------AQAIGQTGRFVLVQRLR 54

  Fly    79 HYEEYLDSSARLLDVITSPHAMPKE--------------EYQLHLRHLATS-----SRKQVPTTD 124
            ..|..|               :|:|              :.|..||....|     |....|..:
Human    55 EKERQL---------------LPQECPVGAQATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPE 104

  Fly   125 KDSGMGS-PVDSSRSMRIRRRGKLLSTKTTDNINTKQSKRSRKQQQRNHHLTPNESLLTIILAQD 188
            :.....| ||....::....|..|          |.:...|..:......:||.....|.:...:
Human   105 RCLIRASLPVKPRAALGCEPRKTL----------TPEPAPSLSRPGPAAPVTPTPGCCTDLRGLE 159

  Fly   189 ETILQQMTML-HEKDRQIFKIEEEKHQVRERELGKNYLLETYLKDLDEPQEKGEDLELFEEMTHI 252
            ..:.:....| ||   ..::.|..:.|.|||| |:..|                           
Human   160 LRVQRNAEELGHE---AFWEQELRREQARERE-GQARL--------------------------- 193

  Fly   253 DVDRDFGIMSDSTVQTALNSGTMQDDIRLYWLE-KIHEVNKELQCEEELLLSLHSKVRRHQVKRA 316
                           .||::.|.:...||..|: :...:..|||...|                |
Human   194 ---------------QALSAATAEHAARLQALDAQARALEAELQLAAE----------------A 227

  Fly   317 YQTKSEVLLQIERLDTELAT---QVADIHH----VERKLFTANEQLKAKLAVLECLSRE 368
            ....|.:....|||..:||.   |.|::..    |.|.|..|...|:|:...||.|:||
Human   228 PGPPSPMASATERLHQDLAVQERQSAEVQGSLALVSRALEAAERALQAQAQELEELNRE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13875NP_001261185.1 None
RASSF7NP_003466.1 RA 8..86 CDD:307093 20/104 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..150 6/37 (16%)
VirB10_like 123..>199 CDD:330184 20/131 (15%)
SMC_N <177..>294 CDD:330553 38/169 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.