DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13875 and Rassf8

DIOPT Version :9

Sequence 1:NP_001261185.1 Gene:CG13875 / 38024 FlyBaseID:FBgn0035104 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_082036.1 Gene:Rassf8 / 71323 MGIID:1918573 Length:419 Species:Mus musculus


Alignment Length:472 Identity:97/472 - (20%)
Similarity:186/472 - (39%) Gaps:133/472 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IWVNGEEHWISGADSSTTCADLICALISYQIDQKHVLSKEEILAPQQFAIVQKQRHYEEYLDSSA 88
            :||:|.:..:.|....|||.:::.||            .:.|....::.:::|.|..|.:|    
Mouse     5 VWVDGVQRIVCGVTEVTTCQEVVIAL------------AQAIGRTGRYTLIEKWRDTERHL---- 53

  Fly    89 RLLDVITSPHAMPKEEYQLHLRHLATSSRKQVPTTDKDSGMGSPVDSSRSMRIRRRGKLLSTK-T 152
                   :||..|                  :.:.:|.....|.|    .:.:||.|..||.: |
Mouse    54 -------APHENP------------------IVSLNKWGQYASDV----QLILRRTGPSLSERPT 89

  Fly   153 TDNI---------------------NTKQSKRSRKQQQRNHHLTPNESLLTIILAQ-DETILQQM 195
            :|::                     ...:|.|.|:.::::...|.....||.|..: .||..:|.
Mouse    90 SDSVARIPERTLYRQSLPPLAKLRPQADKSIRRREPKRKSLTFTGGAKGLTDIFGKGKETEFRQK 154

  Fly   196 TMLH-----EKDRQIFKIEEEKHQVRERELGKN-----YLLETYLKDLD------EPQEKGEDLE 244
            .:.:     |:.:::.:::..|.|..|::|..:     :..:.|...|:      |.:.|..|:|
Mouse   155 VLSNCRATAEELKRLIRLQTGKLQAIEKQLESSEAEIRFWEQKYSCSLEEEIVRLEQRIKRNDVE 219

  Fly   245 LFEE---MTHIDVDRDFGIMSDSTVQTALN---------SGTMQDDIRLYWLEKIHEVNKELQCE 297
            :.||   ...:.::::    ::..:|..|.         .|.::|     :|.:||.:...||.|
Mouse   220 IEEEEFWENELQIEQE----NEKQLQDQLEEIRQKVTDCEGRLKD-----YLAQIHTMESGLQAE 275

  Fly   298 EELLLSLHSKVRRHQVKRAYQTKSEVLLQIERLDTELATQVAD-------IHHVERKLFTANEQL 355
            :     ||.:|:..||     .:.||..:||::..|:..|...       |..|||.|..|.::|
Mouse   276 K-----LHREVQEAQV-----NEEEVKGKIEKVKGEMDLQGQQSLRLENGIRAVERSLGQATKRL 330

  Fly   356 KAKLAVLECLSREFETTVSGGVQEGDVATGSNAS------AKVQQSQSDDLQHAGNWLHVVKRLF 414
            :.|...||.|::|....   .:|:....||:..:      .:::.||:|....|......:||..
Mouse   331 QDKEQELEQLTKELRQV---NLQQFIQQTGTKVTVLPAEPTEIEASQADIETEAPFQSGSLKRPG 392

  Fly   415 AADHL--NRRLTQQALS 429
            ::..|  |.|:.|..:|
Mouse   393 SSRQLPSNLRILQNPVS 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13875NP_001261185.1 None
Rassf8NP_082036.1 RA_RASSF8 2..83 CDD:340551 23/122 (19%)
Smc 109..>380 CDD:224117 62/292 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 372..399 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.